KEGG   Mus pahari (shrew mouse): 110329778
Entry
110329778         CDS       T05929                                 
Symbol
Jam2
Name
(RefSeq) junctional adhesion molecule B
  KO
K06735  junctional adhesion molecule 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04530  Tight junction
mpah04670  Leukocyte transendothelial migration
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110329778 (Jam2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110329778 (Jam2)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110329778 (Jam2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110329778 (Jam2)
CD molecules [BR:mpah04090]
 Proteins
  110329778 (Jam2)
SSDB
Motif
Pfam: Ig_3 ig I-set Ig_2 V-set Ig_6 Izumo-Ig C2-set_2
Other DBs
NCBI-GeneID: 110329778
NCBI-ProteinID: XP_021065304
Ensembl: MGP_PahariEiJ_G0016593
LinkDB
Position
12:76112193..76162171
AA seq 297 aa
MARRPQGLLLLLLLHYLIVALDYHKANGFSASKDHRQEVTVIEFQEAILACKTPKKTTSS
RLEWKKLGQGVSLVYYQQALQGDFKERAEMIDFNIRIKNVTRNDAGEYRCEVSAPTEQGQ
NLQEDTVMLEVLVAPAVPSCEVPTSVMSGSVVELRCQDKEGNPAPEYIWFKDGTSLLGNP
KGGIHNSSYTMNTKSGILQFNMISKMDSGEYYCEARNSVGHRRCPGKRMQVDVLNISGII
AAVVVVAFVTCVCGLSTCYAQRKGYFSRETSFQKGSPASKATTMSENDFKHTKSFII
NT seq 894 nt   +upstreamnt  +downstreamnt
atggcgaggcgcccccaaggcctcctgctgctgctgctgctacactacttgatcgtcgcc
ctggactatcataaggcaaatggattttctgcatcaaaagaccaccgtcaagaagtcaca
gtaatagagttccaagaggctattttagcttgtaaaaccccaaagaagaccacttcctcc
agattggaatggaagaagctggggcagggggtctccttggtctactatcaacaggctctc
caaggtgactttaaagagcgtgctgagatgatagatttcaatatacgaatcaaaaatgtt
acaagaaatgatgctggagagtatcgctgtgaagtcagcgctccgactgagcaaggccag
aacctgcaggaagatacagtcatgctagaagtactagtggctcctgctgttccttcctgt
gaagtacccacttctgttatgagtggaagtgttgtggagctacgatgccaagataaagaa
ggaaatccagctcctgagtacatctggtttaaagatggcacgagtttgctagggaatcca
aaaggcggcatacacaacagctcatacacaatgaacacgaaatctggaattctgcaattc
aacatgatttccaagatggacagtggagagtattactgcgaagcccggaactctgttgga
caccgcaggtgccctgggaagcgaatgcaagtagatgttctcaacataagtggcatcata
gcagctgttgtggtggtggcctttgtgacttgtgtatgtggccttagtacatgctatgct
cagaggaaaggctacttttcaagagaaacttccttccagaagggtagtcctgcatctaaa
gccactacgatgagcgaaaatgatttcaagcatacaaaatcctttataatttaa

DBGET integrated database retrieval system