KEGG   Mus pahari (shrew mouse): 110329780
Entry
110329780         CDS       T05929                                 
Symbol
Igsf11
Name
(RefSeq) immunoglobulin superfamily member 11
  KO
K06791  immunoglobulin superfamily, member 11
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110329780 (Igsf11)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mpah04515]
    110329780 (Igsf11)
Cell adhesion molecules [BR:mpah04515]
 Immunoglobulin superfamily
  CTX family
   110329780 (Igsf11)
SSDB
Motif
Pfam: V-set Ig_3 ig Ig_2 I-set stn_TNFRSF12A DUF4381 DUF2207
Other DBs
NCBI-GeneID: 110329780
NCBI-ProteinID: XP_021065307
Ensembl: MGP_PahariEiJ_G0016452
LinkDB
Position
12:33857221..33986677
AA seq 428 aa
MTRRRSAPASWLLVSLLGVTTSLEVSESPGSVQVARGQTAVLPCAFSTSAALLNLNVIWM
VIPLSNANQPEQVILYQGGQMFDGALRFHGRVGFTGTMPATNVSIFINNTQLSDTGTYQC
LVNNLPDRGGRNIGVTGLTVLVPPSAPQCQIQGSQDLGSDVILLCSSEEGIPRPTYLWEK
LDNTLKLPPTATQDQVQGTVTIRNISALSSGLYQCVASNAIGTSTCLLDLQVISPQPRSV
GIIAGAVGTGAVLIVICLALISGAFFYWRSKNREEEEEEIPNEIREDDLPPKCSSAKAFH
TEISSSENNTLTSSNTYNSRFWNNNPKPHRNTESFNHFSDLRQSFSGNAAIPSIYANGNH
LVLGPHKTLVVTANRGSSPQVMPRNNGSVSRKPWPQHTHSYTVSQMTLERIGAVPVMVPA
QSRAGSLV
NT seq 1287 nt   +upstreamnt  +downstreamnt
atgactcggcggcgctccgctccggcgtcctggctgctcgtgtcgctgctcggtgtcaca
acatccctggaagtgtccgagagcccaggcagtgtccaggtggcccggggccagacggca
gtcctgccctgcgccttctccaccagtgctgccctcctgaacctcaatgtcatttggatg
gtcattcccctctccaatgcaaaccagcccgaacaggtcattctttatcagggtggacaa
atgtttgatggtgccctccggttccatgggagggtaggatttaccggcaccatgcctgct
accaatgtctctatcttcatcaataacacacagctgtcagatacgggcacctaccagtgc
ttggtgaataaccttccagacagagggggcagaaacatcggggtcactggcctcacggtg
ttagtccccccttctgctccacaatgccaaatccaaggatcccaggacctcggcagcgat
gtcatccttctgtgtagttcagaggaaggcatccctcggcccacgtacctttgggagaag
ttagataatacgctcaagctacctccaacagccactcaggaccaggtccagggaacagtc
accatccggaatatcagtgccctctcttctggtctgtaccagtgtgtggcttctaatgcc
atcgggaccagcacctgcctgctggacctccaggttatctcaccccagccccggagcgtt
ggaataattgctggagcggttggcaccggtgctgttcttattgtcatctgccttgcgctg
atttcaggggcgttcttttactggagaagcaaaaacagagaggaggaggaggaagaaatt
cctaatgaaatcagagaggatgatcttccccctaaatgctcttctgccaaagcattccac
acagaaatatcctcctcagaaaataacacgctgacctcttccaatacctacaacagtcga
ttctggaacaacaatccaaaaccccatagaaacacagagtcgttcaaccacttcagtgac
ttacgccagtctttctctggcaatgcagctatcccatccatctatgcaaatgggaaccat
ctggttttgggtccacataagactctggtagttacagccaacagagggtcatcaccccag
gtcatgcccaggaacaatggttcagtcagcaggaagccttggcctcaacacacccattcc
tacacagtaagccaaatgaccctggagcgcatcggtgcagtgcctgtcatggtgcctgcc
cagagtcgggcagggtccctggtatag

DBGET integrated database retrieval system