KEGG   Mus pahari (shrew mouse): 110329804
Entry
110329804         CDS       T05929                                 
Symbol
Nectin3
Name
(RefSeq) nectin-3 isoform X1
  KO
K06592  poliovirus receptor-related protein 3
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110329804 (Nectin3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110329804 (Nectin3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mpah04515]
    110329804 (Nectin3)
   04090 CD molecules [BR:mpah04090]
    110329804 (Nectin3)
Cell adhesion molecules [BR:mpah04515]
 Immunoglobulin superfamily
  Nectin family
   110329804 (Nectin3)
CD molecules [BR:mpah04090]
 Proteins
  110329804 (Nectin3)
SSDB
Motif
Pfam: C2-set_2 Ig_3 ig V-set I-set Ig_2 Ig_6 C1-set PDGLE Sarcoglycan_2 Adeno_E3_CR2
Other DBs
NCBI-GeneID: 110329804
NCBI-ProteinID: XP_021065339
Ensembl: MGP_PahariEiJ_G0016488
LinkDB
Position
12:complement(40976576..41070247)
AA seq 549 aa
MARPPGPAPLCPGGGKAQLSSAFPPAAGLLLPAPTSPPLLLLLIPLLLFSRLCGALAGSI
IVEPHVTAVWGKNVSLKCLIEVNETITQISWEKIHGKSTQTVAVHHPQYGFSVQGDYQGR
VLFKNYSLNDATITLHNIGFSDSGKYICKAVTFPLGNAQSSTTVTVLVEPTVSLIKGPDS
LIDGGNETVAAVCVAATGKPVAQIDWEGDLGEMESTTTSFPNETATIVSQYKLFPTRFAR
GRRITCVVKHPALEKDIRYSFILDIQYAPEVSVTGYDGNWFVGRKGVNLKCNADANPPPF
KSVWSRLDGQWPDGLLASDNTLHFVHPLTVNYSGVYVCKVSNSLGQRSDQKIIYISDPPT
TTTLQPTVQWHSSPADVQEIATEHKKLPFPLSTLATLKDDTVGTIIASVVGGALFLVLVS
ILAGIFCYRRRRTFRGDYFAKNYIPPSDMQKESQIDVLQQDELDSYPDSVKKENKNPVNN
LIRKDYLEEPEKTQWNNVENLTRFERPMDYYEDLKMGMKFVSDERYNESEDGLVSHVDGS
VISRREWYV
NT seq 1650 nt   +upstreamnt  +downstreamnt
atggcgcggcccccgggcccggccccgttgtgtcctggaggcggcaaagcacaactttcc
tcggcgtttcctcccgcggccggactgctgctgccggccccgacgtcgccgccgctgctg
ctgctgctcattcccctgcttctcttctcccggctctgtggtgccttagctggatcaatt
attgtggagccacatgtcacagcagtgtggggaaagaatgtttcattgaagtgtttaatt
gaagtgaatgaaactataacacagatctcctgggagaagatccatggcaaaagtacacag
actgttgcagttcatcaccctcagtatggattctcggttcaaggagattatcagggaaga
gtcttgtttaaaaactattcacttaatgatgcaacaattactctgcataacataggcttc
tcagattctggaaaatatatatgcaaagccgttacattcccacttggaaatgcccagtcc
tctacaactgtgactgtgttagttgaacccacggtgagcctgataaaaggaccggattct
ttaattgatggagggaatgaaacagtagcagccgtttgtgtagcagccactggaaagcca
gtcgcacagattgactgggaaggtgatcttggtgaaatggaatctactacaacttctttt
cccaatgaaacagcaacgattgtcagccaatacaagctgtttcccacaagatttgctcga
ggaaggcgaattacttgtgttgtaaagcatccagccttagaaaaggacattcgatactct
ttcatactagacatacagtatgctcctgaagtttcagtaacaggatatgatggaaattgg
ttcgtgggaagaaaaggtgttaacctcaagtgtaatgctgatgcaaatcctccacccttc
aagtccgtgtggagcaggttggatggacaatggcctgatggtttgttggcgtcagataat
actcttcattttgtccatccactgactgtcaattattctggcgtttatgtctgtaaagta
tcaaattcccttggtcaaagaagtgatcaaaagatcatctacatttcagatcctcctacc
accaccacccttcagccgacagttcagtggcattcctcacctgctgacgtccaggagata
gcaacagagcataaaaaattgccctttccattgtcaactttggcaacacttaaggatgac
acagtcggcaccatcattgctagtgtagtgggtggggctctcttcttagtgcttgtgagc
attttggctgggatattctgctataggagaagacggacgtttcgtggagactactttgcc
aaaaactacattccaccatcagacatgcaaaaagaatcgcaaattgatgttcttcaacag
gatgagcttgattcttacccagacagtgtaaaaaaggaaaacaaaaatccagtgaacaac
ctaatacgtaaagactacttagaggagcctgagaaaactcagtggaataatgtagagaat
ctcactaggtttgaaagaccgatggattactatgaagatctaaaaatgggaatgaagttc
gtcagtgatgaacgctacaatgaaagtgaagatggtttggtttctcatgtagatggctcc
gtaatttccaggagggagtggtatgtctaa

DBGET integrated database retrieval system