KEGG   Mus pahari (shrew mouse): 110330066
Entry
110330066         CDS       T05929                                 
Symbol
Cd86
Name
(RefSeq) T-lymphocyte activation antigen CD86
  KO
K05413  CD86 antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04620  Toll-like receptor signaling pathway
mpah04672  Intestinal immune network for IgA production
mpah04940  Type I diabetes mellitus
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05202  Transcriptional misregulation in cancer
mpah05320  Autoimmune thyroid disease
mpah05322  Systemic lupus erythematosus
mpah05323  Rheumatoid arthritis
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110330066 (Cd86)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110330066 (Cd86)
   04672 Intestinal immune network for IgA production
    110330066 (Cd86)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110330066 (Cd86)
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    110330066 (Cd86)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    110330066 (Cd86)
   05323 Rheumatoid arthritis
    110330066 (Cd86)
   05320 Autoimmune thyroid disease
    110330066 (Cd86)
   05330 Allograft rejection
    110330066 (Cd86)
   05332 Graft-versus-host disease
    110330066 (Cd86)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110330066 (Cd86)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110330066 (Cd86)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110330066 (Cd86)
   04090 CD molecules [BR:mpah04090]
    110330066 (Cd86)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110330066 (Cd86)
CD molecules [BR:mpah04090]
 Proteins
  110330066 (Cd86)
SSDB
Motif
Pfam: V-set Ig_3 I-set V-set_CD47 Phage_holin_3_6
Other DBs
NCBI-GeneID: 110330066
NCBI-ProteinID: XP_021065669
Ensembl: MGP_PahariEiJ_G0016418
LinkDB
Position
12:complement(31593784..31618337)
AA seq 362 aa
MAKTIWRLSVAFSTLSTGDPQYEILLPLPLKGWTPVLTHNASLYCFSLVFLNFSTMGLAI
LIFVTVLLISDAVSIKSHAYVSKTADLPCPFTKAQNISLSELVVFWQDQQKLVLYEHYLG
TEKLDSVHAKYLGRTSFDRDNWTLRLHNVQIKDMGSYDCFIQKKPPTGTIILQQTLTELS
VTANYSEPEIKLVQNVTRNSGMNLTCMSKQGHPKPTKMYFLITNSTNEYGDDMQISQDNV
TELFSASISLSLPFPDGVRSLTVVCVLETESMKISSKSYNLTLPESQPVQKYWLETGASI
TVLLVVLLLIILVVKIYHKKQDRPSRPSNTTHTLERDSHADRESINLEELEPQIASAKPN
AE
NT seq 1089 nt   +upstreamnt  +downstreamnt
atggccaaaactatctggagactctctgtggccttttcgacactctcaacaggggatccc
cagtatgagatcctcctacctctacctctcaagggttggactccagtcctgacccacaat
gcctctctctactgtttttctcttgtctttttaaacttcagcaccatgggcttggcaatc
cttatctttgtgacagtcttgttgatctcagatgctgtttcaataaagagccacgcttat
gtcagtaagactgcggacctgccgtgcccatttacaaaggctcagaacataagcctgagt
gagctggtagtattttggcaggaccagcaaaagttggttctgtacgagcactacttgggc
acagagaaacttgatagtgtgcatgccaagtacctgggccgcacgagctttgacagggat
aactggaccctacgacttcacaatgttcagatcaaggacatgggctcatatgattgtttt
atacaaaaaaagccacccacaggaacgattatcctccaacagacattaacagagctgtca
gtgaccgccaactacagtgaacctgaaataaaactggttcagaatgtaacaagaaattcg
ggcatgaatttgacctgcatgtctaagcaaggtcacccgaaacctacgaagatgtatttt
ctgataactaattcaactaatgagtatggtgatgacatgcagatatcacaagataacgtc
acagaactgttcagtgcctccatcagcctatctcttccattcccggatggtgtgaggagt
ttgaccgttgtttgtgttctggaaacggaatcaatgaagatttcctccaaatcttacaat
ttaactcttccagagtcccaacctgttcaaaagtattggctcgagactggagcttccatt
actgtgctccttgtcgtgctgctgctgatcatcctagtggtaaaaatctatcacaagaag
caggaccggcctagcaggcccagcaacacaacccatacgttagagcgggatagtcatgct
gacagagaatcaatcaacctggaggaacttgaaccccaaattgcatcagcaaaaccaaat
gcagagtga

DBGET integrated database retrieval system