Mus pahari (shrew mouse): 110331003 Help Entry 110331003         CDS       T05929                                  Symbol Cxcl6 Name (RefSeq) C-X-C motif chemokine 6   KO K05506   C-X-C motif chemokine 5/6 Organism mpah  Mus pahari (shrew mouse) Pathway mpah04060   Cytokine-cytokine receptor interaction mpah04061   Viral protein interaction with cytokine and cytokine receptor mpah04062   Chemokine signaling pathway mpah04657   IL-17 signaling pathway mpah04668   TNF signaling pathway mpah05133   Pertussis mpah05323   Rheumatoid arthritis Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     110331003 (Cxcl6)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110331003 (Cxcl6)    04061 Viral protein interaction with cytokine and cytokine receptor     110331003 (Cxcl6)  09150 Organismal Systems   09151 Immune system    04657 IL-17 signaling pathway     110331003 (Cxcl6)    04062 Chemokine signaling pathway     110331003 (Cxcl6)  09160 Human Diseases   09171 Infectious disease: bacterial    05133 Pertussis     110331003 (Cxcl6)   09163 Immune disease    05323 Rheumatoid arthritis     110331003 (Cxcl6)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpah04052]     110331003 (Cxcl6) Cytokines and neuropeptides [BR:mpah04052]  Cytokines   Chemokines    110331003 (Cxcl6) SSDB OrthologParalogGFIT Motif Pfam:  IL8 YxzF Motif Other DBs NCBI-GeneID:  110331003 NCBI-ProteinID:  XP_021066976 Ensembl:  MGP_PahariEiJ_G0017170 LinkDB All DBs Position 13:79411382..79413369 Genome browser AA seq 133 aa AA seqDB search MRFQLRSSAGIPSGSSSPFKLLAPLAFLLLFTLPQRLAEAAPSSVIAASELRCVCLTVTP RINPKLIANLEVIPAGPQCPTVEVIAKLKNQKEVCLDPEAPVIKKIIQKILDSEKKKTKR NALAVERSAAGVQ NT seq 402 nt NT seq  +upstreamnt  +downstreamnt atgcgcttccagctccgcagctccgccggcatccccagcggttccagctctccattcaag ctgctggcgccgctggcgtttctgttgctgttcacactgccgcagcgtctagctgaagct gccccttcctcagtcatagccgcatctgagctgcgttgtgtttgcttaaccgtaactcca agaattaatcccaaattgatcgctaatttggaggtgatccctgcaggtccacagtgccct acggtggaagtcatagctaaactgaagaaccagaaggaggtctgtctggacccagaagct cctgtgataaagaagatcattcagaaaatattggacagtgaaaaaaagaaaactaagcga aacgcacttgctgtggaaagatctgcggccggtgttcaatag

DBGET integrated database retrieval system