KEGG   Mus pahari (shrew mouse): 110331423
Entry
110331423         CDS       T05929                                 

Gene name
Axin2
Definition
(RefSeq) axin-2
  KO
K04385  axin 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04310  Wnt signaling pathway
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04934  Cushing syndrome
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05210  Colorectal cancer
mpah05213  Endometrial cancer
mpah05217  Basal cell carcinoma
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110331423 (Axin2)
   04390 Hippo signaling pathway
    110331423 (Axin2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110331423 (Axin2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110331423 (Axin2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110331423 (Axin2)
   05225 Hepatocellular carcinoma
    110331423 (Axin2)
   05226 Gastric cancer
    110331423 (Axin2)
   05217 Basal cell carcinoma
    110331423 (Axin2)
   05213 Endometrial cancer
    110331423 (Axin2)
   05224 Breast cancer
    110331423 (Axin2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110331423 (Axin2)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110331423 (Axin2)
   05022 Pathways of neurodegeneration - multiple diseases
    110331423 (Axin2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110331423 (Axin2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:mpah03036]
    110331423 (Axin2)
Chromosome and associated proteins [BR:mpah03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    110331423 (Axin2)
SSDB
Motif
Pfam: RGS DIX AXIN1_TNKS_BD Axin_b-cat_bind
Other DBs
NCBI-GeneID: 110331423
NCBI-ProteinID: XP_021067653
Ensembl: MGP_PahariEiJ_G0018474
LinkDB
Position
14
AA seq 839 aa
MSSAVLVTLLPDPSSSFHEDAPRPPVPGEEGETRPCQPSVGKVQSTKPMPVSSNARRNED
GLGEPEGRASPESPLTRWTKSLHSLLGDQDGAYLFRTFLEREKCVDTLDFWFACNGFRQM
NLKDTKTLRVAKAIYKRYIENNSVVSKQLKPATKTYIRDGIKKQQIGSVMFDQAQTEIQA
VMEENAYQVFLTSDIYLEYVRSGGENTAYMSNGGLGSLKVLCGYLPTLNEEEEWTCADLK
CKLSPTVVGLSSKTLRATASVRSTETAENGFRSFKRSDPVNPYHVGSGYVFAPATSANDS
ELSSDALTDDSMSMTDSSVDGIPPYRMGSKKQLQREMHRSVKANGQVSLPHFPRTHRLPK
EMTPVEPAAFAAELISRLEKLKLELESRHSLEERLQQIREDEEKEGSEQALSSRDGAPVQ
HPLALLPSSSYEEDPQTILDDHLSRVLKTPGCQSPGVGRYSPRSRSPDHHHHHHHQQCHT
LLPTGGKLPPVAACPLLGGKSFLTKQTAKHVHHHYIHHHAVPKTKEEMEAEATQRVRCLC
PGGTDYYCYSKCKSHPKAPEPLPGEQFCGSRGGTLPKRNARGTEPGLALPAREGGMSSAA
GGPQLPGEEGDRSQDVWQWMLESERQSKSKPHSAQSIRKSYPLESVRAAPGERVSRHHLL
AASGHPRSVARAHPFTQDPAVLPLTPPNTLAQLEEACRRLAEVSKPQKQRCCVASQQRDR
NHSATGQAGVSPSANPSLAPEDHKEPKKLASVHALQASELVVTYFFCGEEIPYRRMLKAQ
SLTLGHFKEQLSKKGNYRYYFKKASDEFACGAVFEEIWDDETVLPMYEGRILGKVERID
NT seq 2520 nt   +upstreamnt  +downstreamnt
atgagtagcgccgtgttggtgactcttcttccagatcccagcagcagcttccacgaggat
gctccgcggcccccggttccgggagaagaaggggagacccggccgtgtcagcctagtgtg
ggcaaggtccagtccaccaaacctatgcctgtctcttctaacgctaggcggaatgaagat
gggctgggggagcccgaggggcgggcctcccccgagtcccctttgaccaggtggaccaag
tctttgcactccttgctgggtgaccaggacggggcatatctcttccggactttcctggag
agggagaaatgtgtggatactctggacttctggtttgcctgtaatgggttcaggcagatg
aacctgaaggataccaaaactttgcgagtggccaaagcaatctataagaggtacattgag
aacaacagtgttgtctccaagcagctgaagcccgccaccaagacctacatacgagatggc
atcaagaagcaacagatcggctcggtcatgtttgaccaggcgcagaccgagatccaggcg
gtgatggaggaaaatgcctaccaggtgttcttgacttctgacatttacctggaatatgtg
aggagtgggggggaaaacacagcttacatgagtaacgggggactggggagcctaaaggtc
ttatgtggctacctccccaccttgaatgaagaagaggagtggacatgtgccgacctcaag
tgcaaactctcacccaccgtggttggcttgtccagcaaaactcttcgggccaccgcgagt
gtgagatccacggaaacagctgaaaacggattcaggtccttcaagagaagcgacccggtt
aatccttatcatgtaggctccggctatgtctttgcaccagccaccagtgccaacgacagc
gagttatccagcgacgcgctgaccgacgattccatgtccatgacggacagtagcgtagat
ggaatccctccttaccgcatgggcagtaagaaacagctccagagagagatgcaccgcagt
gtgaaggccaatggccaagtgtctctacctcattttccgagaacccaccgcctgcccaag
gagatgacgcctgtggaacctgctgccttcgccgccgagctcatctccaggctggagaag
ctgaaattggagctggaaagccgccacagtctggaggagcggctgcagcagatccgggag
gatgaagaaaaggaggggtctgagcaggccctgagctcacgggatggagcaccggttcag
caccccctggccctcctaccctccagcagctatgaagaagacccacaaaccattttggac
gaccacctatccagggtcctcaagacccccggctgccagtcccccggtgtgggtcgctac
agcccacggtcccgctcccccgaccaccaccaccaccaccaccatcagcagtgtcacacc
cttcttccgaccgggggcaagctgccccccgtggctgcttgccccctccttggaggcaag
agcttcctgaccaaacagacggcgaagcacgtccaccaccactacatccaccaccacgcc
gtccccaagaccaaggaggagatggaggcagaagccacacagagagtccgctgcctctgc
ccgggaggaacggattattactgctactccaaatgcaagagccacccgaaggccccagag
ccgctgcctggggagcagttttgtggcagcagaggtggtaccttgccaaaacggaatgcg
aggggcacagaaccgggtcttgcgctgccggccagggaaggagggatgtccagtgcagcg
gggggcccccagcttcctggggaagaaggagaccggtcacaggatgtctggcagtggatg
ttggagagtgagcggcagagcaagtccaagccccatagtgcccaaagcataagaaagagc
tacccattagagtctgtccgggctgccccaggcgaacgagtcagccggcaccatctgttg
gcggccagcggacacccccgctcagtggcccgggcccacccatttacccaggaccctgca
gtgcttcccctaaccccacccaacaccttggcacagctggaggaagcctgccgcaggctg
gcagaggtgtcgaagccccagaagcagcggtgctgcgtggccagtcagcagagggacagg
aaccactcggccactggtcaggcaggagtttcaccctctgccaacccaagcctggcgcca
gaagatcacaaagagccaaagaaactggcaagtgtccacgcgctccaggccagcgagctg
gttgtcacctactttttctgtggagaagaaattccataccggaggatgctgaaggctcag
agcttgaccctgggccacttcaaggagcagctcagcaaaaagggaaattacaggtattac
ttcaagaaggcgagtgatgaatttgcctgcggagcagtttttgaggagatctgggacgac
gagacggtgctccccatgtacgaaggcaggatcctgggcaaagtggagaggatcgactga

KEGG   Mus pahari (shrew mouse): 110338127
Entry
110338127         CDS       T05929                                 

Gene name
Axin1
Definition
(RefSeq) axin-1 isoform X1
  KO
K02157  axin 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04310  Wnt signaling pathway
mpah04390  Hippo signaling pathway
mpah04550  Signaling pathways regulating pluripotency of stem cells
mpah04934  Cushing syndrome
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05165  Human papillomavirus infection
mpah05200  Pathways in cancer
mpah05210  Colorectal cancer
mpah05213  Endometrial cancer
mpah05217  Basal cell carcinoma
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    110338127 (Axin1)
   04390 Hippo signaling pathway
    110338127 (Axin1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04550 Signaling pathways regulating pluripotency of stem cells
    110338127 (Axin1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110338127 (Axin1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110338127 (Axin1)
   05225 Hepatocellular carcinoma
    110338127 (Axin1)
   05226 Gastric cancer
    110338127 (Axin1)
   05217 Basal cell carcinoma
    110338127 (Axin1)
   05213 Endometrial cancer
    110338127 (Axin1)
   05224 Breast cancer
    110338127 (Axin1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110338127 (Axin1)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110338127 (Axin1)
   05022 Pathways of neurodegeneration - multiple diseases
    110338127 (Axin1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    110338127 (Axin1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpah01009]
    110338127 (Axin1)
Protein phosphatases and associated proteins [BR:mpah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110338127 (Axin1)
SSDB
Motif
Pfam: DIX RGS AXIN1_TNKS_BD Axin_b-cat_bind Rootletin
Other DBs
NCBI-GeneID: 110338127
NCBI-ProteinID: XP_021077020
Ensembl: MGP_PahariEiJ_G0023592
LinkDB
Position
21
AA seq 868 aa
MQSPKMNVQEQGFPLDLGASFTEDAPRPPVPGEEGELVSTDSRPVNHSFCSGKGTSIKSE
TSTATPRRSDLDLGYEPEGSASPTPPYLRWAESLHSLLDDQDGISLFRTFLKQEGCADLL
DFWFACSGFRKLEPCDSNEEKRLKLARAIYRKYILDSNGIVSRQTKPATKSFIKDCVMKQ
QIDPAMFDQAQTEIQSTMEENTYPSFLKSDIYLEYTRTGSESPKVCSDQSSGSGTGKGMS
GYLPTLNEDEEWKCDQDADEDDGRDSLPPSRLTQKLLLETAAPRAPSSRRYSEGRELRYG
SWREPVNPYYVNSGYALAPATSANDSEQQSLSSDADTLSLTDSSVDGIPPYRIRKQHRRE
MQESIQVNGRVPLPHIPRTYRMPKEIRVEPQKFAEELIHRLEAVQRTREAEEKLEERLKR
VRMEEEGEDGEMPSGPMASHKLPSVPAWHHFPPRYVDMGCSGLRDAHEENPESILDEHVQ
RVMRTPGCQSPGPGHRSPDSGHVAKTAVLGGTASGHGKHVPKLGLKLDPAGLHHHRHVHH
HVHHNSARPKEQMEAEAARRVQSSFSWGPETHGHAKPRSYSENTGTTLSAGDLAFGGKTS
APSKRNTKKAESGKNANAEVPSTTEDAEKNQKIMQWIIEGEKEISRHRKAGHGSSGMRKQ
QAHESSRPLSIERPGAVHPWVSAQLRNSVQPSHLFIQDPTMPPNPAPNPLTQLEEARRRL
EEEEKRANKLPSKQRYVQAVMQRGRTCVRPACAPVLSVVPAVSDLELSETETKSQRKAGG
GSAPPCDSIVVAYYFCGEPIPYRTLVRGRAVTLGQFKELLTKKGSYRYYFKKVSDEFDCG
VVFEEVREDEAVLPVFEEKIIGKVEKVD
NT seq 2607 nt   +upstreamnt  +downstreamnt
atgcagagtcccaaaatgaatgtccaggagcagggtttccccttggacctcggagcaagt
ttcactgaagatgccccccggcccccagtgcctggagaagagggagaactggtatctact
gattcgaggcctgtcaaccacagtttctgctctgggaaaggtaccagcattaagagtgag
acctcaacagccaccccaagacgttcagatctggatctgggatatgagcccgagggcagt
gcttcccccaccccaccatatttgaggtgggctgagtcactgcattccttactggatgac
caagatgggatcagcctgttcaggactttcctgaagcaggagggctgtgctgacctgctg
gacttctggtttgcctgcagtggcttcaggaagcttgagccctgtgactcaaatgaggaa
aagaggctgaagctggcaagagccatctaccgaaagtacatcctggatagcaatggcatt
gtgtccagacaaaccaagccagccactaagagcttcataaaggactgtgtcatgaagcag
cagatcgatcctgccatgtttgaccaggcacagacagaaatccagtccaccatggaggag
aatacctacccttccttccttaagtctgacatttatttggagtacacaaggacaggctca
gagagtccgaaggtctgcagtgaccagagctcagggtctggaacagggaagggcatgtct
ggatacctgcccactttgaatgaagatgaagaatggaaatgtgaccaagatgcagatgag
gatgatggccgagactctctcccccccagcaggctcacccagaagctgctattggagact
gctgccccgagggccccctcaagtagacggtacagcgaaggcagagagctcaggtatgga
tcttggagggagcccgtcaacccctactacgtcaattctggctatgccctggccccagcc
accagtgccaatgacagtgagcagcagagcctgtccagtgatgctgacactctgtccctt
acggacagtagcgtggatggaatccccccatacaggatccgtaagcagcaccgaagggag
atgcaggagagtatccaagtcaatgggcgggtacctctacctcacattcctcgcacttac
cgaatgccaaaggagatccgggtagaaccacagaaatttgctgaagagcttattcaccgt
ttagaggctgtccagcgtactcgagaggctgaagaaaagttggaggaacggctgaaacgt
gtacgcatggaggaagaaggggaggatggtgaaatgccttctggccccatggccagtcac
aagctgccttctgtcccagcttggcatcatttcccaccccgctatgtggatatgggctgc
tctggactgcgggatgcccatgaagagaatcctgagagcatcctggatgagcatgtgcaa
agggtcatgaggacacctggctgccagtcacctggcccaggccaccgctctcctgacagt
gggcatgtggctaagactgcagtgctagggggtacagcctccgggcatgggaagcatgtt
cctaagttagggctgaagctggatccagctggcctgcaccatcataggcacgtccaccac
catgttcaccataattcagctcgaccgaaggagcaaatggaggctgaagctgcccgcagg
gtccagagcagcttctcatggggcccagaaacacatggtcatgccaagccccggagctat
tcagagaacacaggcaccaccctcagtgctggggatttggcctttggtggtaaaactagt
gcaccctccaaaagaaacaccaagaaggctgaatctgggaagaatgccaatgctgaggtg
cccagtaccacagaggatgcagagaagaaccagaagatcatgcagtggatcattgagggc
gagaaggagatcagtagacaccggaaggcaggccatgggtcttctggaatgaggaagcag
caggcccatgaaagctccagacccttgtctattgagcgtcctggggccgtgcacccctgg
gtcagtgctcagcttcggaactctgtccagccttctcatcttttcatccaagatcccaca
atgccacccaatccagcccctaatcccctgacccagctggaagaggcccgcaggcgtttg
gaagaagaagaaaagagagcaaacaaactgccctccaagcagaggtatgtgcaggcagtc
atgcagcggggacgcacctgtgtcaggccagcttgtgcaccggtgctgagtgtggtacca
gccgtgtcggatttggaactctccgagacagagacaaaatcacaaagaaaggcaggtggc
gggagtgcaccaccatgtgacagcattgttgtggcctactatttctgtggggaacccatt
ccctaccggaccctggtgaggggccgtgctgtcaccctgggccagttcaaggagctgcta
accaagaaggggagctacagatactactttaagaaagtgagtgacgagtttgactgtggt
gtggtatttgaggaagtacgggaggatgaggccgtcttgcctgtctttgaagaaaagatc
atcggcaaggtggagaaggtggactga

DBGET integrated database retrieval system