KEGG   Mus pahari (shrew mouse): 110331461
Entry
110331461         CDS       T05929                                 

Gene name
Llgl2
Definition
(RefSeq) lethal(2) giant larvae protein homolog 2
  KO
K06094  lethal(2) giant larvae protein
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
mpah04530  Tight junction
mpah05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110331461 (Llgl2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110331461 (Llgl2)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110331461 (Llgl2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110331461 (Llgl2)
Membrane trafficking [BR:mpah04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    110331461 (Llgl2)
SSDB
Motif
Pfam: LLGL WD40
Other DBs
NCBI-GeneID: 110331461
NCBI-ProteinID: XP_021067742
Ensembl: MGP_PahariEiJ_G0018548
LinkDB
Position
14
AA seq 1027 aa
MRRFLRTGHDPARERLKRDLFQFNKTVEHGFPHQPSALGYSPSLRILAIGTRSGAVKLYG
APGVEFMGLHKENNAVLQIHFLPGQCQLVTLLDDNSLHLWSLKVKGGVSELQEEESFTLR
GPPGAAPSATQITEILPHSSGELLYLGTESGNVFVVQLPGFRTLHDRTICSDEVLQWLPE
EARHRRVFEMVEALQEHPRDPNQILIGYSRGLIVIWDLRGSRVLSHFLSSQQLENASWQR
DGCLIVTCHSDGSHCQWPVSSDTQNPEPLRSSIPYGPFPCKAIMKIFWLTTRQGLPFTIF
QGGMPRASYGDRHCISVVHNGQQTAFDFTSRVIDFTVLAEADPAAAFDDPYALVVLAEEE
LVVIDLRTPGWPPVQLPYLASLHCSAITCSHHVSNIPLKLWERIIAAGSRQNSHFSTMEW
PIDGGTSLAPPPPQRDLLLTGHEDGTVRFWDASGVCLRLLYKLSTVRVFLTDTDVSENLS
AQGEDEWPPLRKVGSFDPYSDDPRLGIQKIFLCKYSGYLAVAGTAGQVLVLELNDEAAEH
AVEQVEADLLQDQEGYRWKGHERLAARPGPVCFEAGFQPFVLVQCQPPAVVTSLALHSEW
RLVAFGTSHGFGLFDHQQRRQVFVKCTLHPSDQLALEGPLSRVKSLKKSLRQSFRRMRRS
RVSSHKRRPGGPTGEVQAHAVNTKAERTGLQNMELAPVQRKIEARSAEDSFTGFVRTLYF
ADTYLRDSSRHCPSLWAGTNGGTVYAFSLRVPPAERRMDEPVRAEQAKEIQLMHRAPVVG
ILVLDGHNVPLPEPLEVAHDLSKSPDMQGSHQLLVVSEEQFKVFTLPKVSAKLKLKLTAL
EGSRVRRVGVAHFGSYRAEDYGEHHLAVLTNLGDIQVVSMPLLKPQVRYSCIRREDVSGI
ASCVFTKYGQGFYLISPSEFERFSLSTKWLVEPRCLVDSTKAKKHNRPSNGNGTGPKMAF
SGQVRNSRSQSDGDEKKPGPVMEHALLSDAWVLKEIQSTLEGDRGSYGSWHPHRVAVGCR
LSNGGAE
NT seq 3084 nt   +upstreamnt  +downstreamnt
atgaggcggttcctgagaactggacatgaccctgccagggagaggctgaagcgggatctg
ttccagtttaacaagacggtggagcatggcttcccacaccagcccagcgcccttggctat
agcccttcgctacgcatcctggccatcggaacccgctctggagctgtcaagctatatggc
gcccccggggtagagttcatggggcttcacaaggagaacaacgcagtcctgcagatccac
ttcctgcctggtcagtgtcagctggtcactctactggatgacaacagcctgcacctgtgg
agcctgaaagtcaagggtggggtgtcagagctgcaggaagaagagagcttcacgttgcgt
ggccccccaggggctgcccccagtgccacacagatcactgagatcctacctcattcttcc
ggagaactgctctacctgggcaccgagagcggcaatgtgtttgtggtgcagctcccgggg
ttccgcacactgcacgacaggaccatctgttcagacgaggtgctgcaatggttgccagag
gaggctcgccaccggcgagtgtttgagatggtggaggctctgcaggagcaccctcgagac
cccaaccaaatcctcattggctacagccgaggcctcatcgtcatctgggaccttcggggc
agccgagtgctcagtcatttcctcagcagccagcaactggagaatgccagctggcagcgg
gatggctgcctgattgtcacctgccactctgacggcagccactgccagtggcccgtgtcc
agtgacacccagaacccagaacctctgcgcagctctataccttatggtccctttccttgc
aaagctataatgaaaatcttctggcttaccaccaggcaagggttgcccttcaccatcttc
cagggcggtatgccacgggccagttatggggaccgccactgcatctcagtggtccacaac
ggccagcagacggccttcgactttacctcccgggtcatcgacttcactgttctcgcagag
gctgaccctgcggctgcctttgatgacccctacgccctggtggtgctagccgaggaggaa
ctggtggtaattgacctgcggacacccggctggccaccagtccagctgccctacctggct
tccttgcactgttcggccatcacctgctcccaccacgtctccaacatccccctgaagcta
tgggaacgcatcatcgcagcgggcagccgccagaactcgcacttctctaccatggagtgg
cccatagatggtggcaccagcctggccccaccgccacctcagagggacctgctgctcaca
gggcacgaggacggcacggtgcggttctgggatgcctcgggtgtatgcttacgactgctg
tacaaactgagcactgtgagggtgttcctcacagacacagacgtcagcgaaaacctcagt
gcccagggtgaggacgagtggcccccactccgcaaggtgggttcctttgatccctacagc
gatgatcctcggctgggcatccagaagattttcctctgtaaatacagcggctacctggct
gtggcaggcacggcagggcaggtgctggtgctggagttgaatgacgaggctgccgagcat
gctgtggagcaggtggaggctgacctgctgcaggaccaggaaggttaccgctggaagggg
cacgagcgcctcgccgcccgccccgggcccgtgtgctttgaggcggggtttcagcccttt
gtcctggtacagtgccagcccccagctgtagtcacctccttggctctgcactccgagtgg
cggcttgtggcctttggcaccagccatggtttcggcctctttgatcaccagcagcggcgg
caggtctttgtcaagtgcacacttcaccccagtgaccagctggccttggagggccctctg
tcccgagtaaagtccctcaagaagtctctgcgtcagtcattccgtcggatgcgccgcagc
agagtgtccagtcataaacggcggcctggtggccccacaggcgaggtgcaggctcacgct
gtgaacaccaaggcggagcggacaggcctgcagaacatggagttggcacccgtgcagcgg
aagattgaggcccgctccgccgaggactccttcaccggctttgtccggaccctctatttc
gctgatacctatctgagggacagctcccgccactgtccctccctgtgggctggcaccaat
ggaggcactgtctacgccttttccctgcgcgtgcctcctgcagaaagaagaatggatgaa
cctgtccgggcagagcaggccaaggagatccagctaatgcatcgtgcgcctgtggtggga
atcctggtgcttgacggacacaatgtaccccttcctgagcccctggaagttgcccatgac
ctgtcgaagagcccagacatgcaagggagtcaccaattgcttgtggtgtcggaggagcaa
ttcaaggtattcacactgcccaaggtgagcgccaaactgaagctgaagctgacggccctg
gagggctcacgggtgcggagagtcggcgtcgcccactttggcagctacagggctgaggac
tacggggagcaccacctggcagtgctcaccaacttgggtgacatccaggtggtctcaatg
cccctgctcaagccccaggtgcggtatagctgcatccgccgggaggacgtcagcggcata
gcctcctgtgtcttcaccaaatatggccaaggtttctatctgatatcaccttcggagttc
gagcgcttttctctctccaccaagtggctggttgagccccggtgtttggtggattcaacc
aaagccaagaagcacaaccggcccagcaatggcaatggcacaggccccaaaatggcattc
tcgggccaagtcaggaactcaaggagccaaagtgatggagatgagaagaagccgggcccc
gtgatggagcacgcactgctcagtgacgcctgggtcctaaaggaaatccagagcacgctg
gagggggaccgggggagctatggcagttggcatcctcaccgcgtggctgtgggttgcagg
ctcagcaatggaggagcagagtga

KEGG   Mus pahari (shrew mouse): 110331764
Entry
110331764         CDS       T05929                                 

Gene name
Llgl1
Definition
(RefSeq) lethal(2) giant larvae protein homolog 1 isoform X1
  KO
K06094  lethal(2) giant larvae protein
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04390  Hippo signaling pathway
mpah04530  Tight junction
mpah05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110331764 (Llgl1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    110331764 (Llgl1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110331764 (Llgl1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110331764 (Llgl1)
Membrane trafficking [BR:mpah04131]
 Exocytosis
  Small GTPases and associated proteins
   Rab associated proteins
    110331764 (Llgl1)
SSDB
Motif
Pfam: LLGL Lgl_C WD40
Other DBs
NCBI-GeneID: 110331764
NCBI-ProteinID: XP_021068286
Ensembl: MGP_PahariEiJ_G0017589
LinkDB
Position
14
AA seq 1062 aa
MMKFRFRRQGADPQREKLKQELFAFHKTVEHGFPNQPSALAFDPELRIMAIGTRSGAVKI
YGAPGVEFTGLHRDAATVTQMHFLPGQGRLLTLLDDSSLHLWEIIHHNGCAHLEEGLSFH
PPSRPSFDNASFPASLTRVTVVLLVAGNTAALGTESGSIFFLDVATLALLEGQTLSPDVV
LRSVPDDYRCGKALGPVESLQGHLQDPSKILIGYSRGLLVIWSQATQSVDNVFLGNQQLE
SLCWGRGGSSIISSHSDGSYAIWSTDTGSPPTLQPTVVTTPYGPFPCKAINKILWRSCES
GDHFIIFSGGMPRASYGDRHCVSVLRAETLVTLDFTSRVIDFFTVHSTQPADEFDNPQAL
AVLLEEELVVLDLQTPGWPAVPAPYLAPLHSSAITCSAHVANVPSKLWARIVSAGERQSP
QPASSALSWPITGGRNLAQEPSQRGLLLTGHEDGTVRFWDASGVALRPLYKLSTAGLFQT
DCEHADSLAQAVEDDWPPFRKVGCFDPYSDDPRLGIQKVALCKYTAQMVVAGTAGQVLVL
ELSEFPAEHAVSVANVDLLQDREGFTWKGHERLNPHTGLLPWPAGFQPRMLIQCLPPAAV
TAVTLHAEWSLVAFGTSHGFGLFDYQRKSPVLARCTLHPNDSLAMEGPLSRVKSLKKSLR
QSFRRIRKSRVSGKKRAPAASSKLQEANAQLAEQTCPHDLEMTPVQRRIEPRSADDSLSG
VVRCLYFADTFLRDATHHGPTMWAGTNSGSVFAYALEVPAATAGGEKRPEQAVEAVLGKE
VQLMHRAPVVAIAVLDGRGRPLPEPYEASRDLAQAPDMQGGHAVLIASEEQFKVFTLPKV
SAKTKFKLTAHEGCRVRKVALATFASVMSEDYTETCLACLTNLGDVHVFSVPGLRPQVHY
SCIRKEDISGIASCVFTRHGQGFYLISPSEFERFSLSARNITEPLCSLDISWPQNATQPR
LQESPKLSQANGTRDIILAPESCQGSPSSAHSKRADTTEPPEATLSPVSIDSAASGDTML
DTTGDVTVEYVKDFLGSPEDSEKNLRNLEADDACRAYTLLIK
NT seq 3189 nt   +upstreamnt  +downstreamnt
atgatgaagtttcggttccggcggcagggcgccgacccgcagcgcgagaagctcaagcag
gagctcttcgccttccacaagactgtggagcatggcttccccaatcagccgagcgccttg
gccttcgaccctgagctccgcatcatggccatcggcaccaggtctggggccgtcaagatc
tatggtgcacctggagtggaatttacaggcctacatcgggatgcagccaccgtcacccag
atgcatttcctgcctggtcagggccgcctcctgaccctgctagatgacagcagcttgcat
ctctgggagatcatccatcataatggctgtgcccacttggaggaaggcctcagcttccac
ccccccagcaggcccagttttgacaatgccagtttccctgccagtctaacccgtgtcact
gtggtcctgctcgtagctggcaatacagcagccctgggaaccgagagtggtagcatattc
tttctggatgtagccaccctggcactgctggaggggcagactctcagcccagatgtggtt
ctgcgcagtgtgccagatgactaccggtgtggaaaggccttgggccctgtggagtcactc
cagggacatctgcaagaccccagcaagatccttataggctacagtcggggcttactggtc
atctggagccaggccacacagtctgtggacaacgttttcctgggtaaccagcagctggag
agcctgtgttggggccgtggtggcagcagcattatcagctcacacagtgacggcagctat
gccatctggtccacagacactggcagccccccaacgctgcagcccactgtagtgaccaca
ccctacggccccttcccctgcaaggccatcaacaagattctgtggcggagctgtgagtca
ggagaccactttatcatcttcagtggtggcatgcctcgagccagctatggtgaccgccac
tgtgtgagtgtactgcgagcagagacactggtgaccctagacttcacctcccgtgtcatt
gacttcttcacggtgcacagcacacagccagcggatgaatttgacaacccccaggcccta
gccgtgcttctggaggaggagctggtggtgctggacctgcaaacgccaggctggccagct
gtgcccgccccttacctggccccactgcattcgtcagctatcacctgctctgcccatgtt
gccaatgtccccagcaagctgtgggcccgcattgtaagtgctggtgagcggcagagccca
cagcctgcctccagtgccttgagttggcccattaccgggggccggaacttggctcaggaa
ccctcgcagcgtgggctgctgctgaccggccatgaggatggcactgtacggttctgggac
gcctctggtgtggcactaaggccactctacaaactgagcacggctggcctcttccagacg
gattgtgaacacgctgacagcctggcccaggctgtggaggatgactggccgcccttccgc
aaggtgggctgctttgatccctacagtgatgaccctcggctaggaatccagaaggttgcg
ctttgcaaatacacagcccagatggtggtggccggcactgcaggccaggtgctggtgctg
gagctcagtgagttccctgcagagcatgccgtcagtgtggccaacgtggatcttcttcag
gatcgtgagggcttcacctggaagggccacgagcggctgaaccctcacacagggctgctg
ccgtggcctgccggattccaacctcgcatgctgatacagtgcctcccacccgctgctgtc
accgctgtcacactccatgctgagtggagccttgtggcctttggtaccagtcatggcttt
ggcctttttgactaccagcgcaagagccctgtgctggctaggtgcacccttcaccccaat
gactctttggccatggaggggccactgtcacgggtgaagtccctcaagaagtcactgcga
cagtcattccggcgaatccgcaagagccgtgtctcaggcaaaaaacgggctcctgctgcc
agtagcaagttacaggaggccaatgcccagctggccgagcagacctgcccacacgacttg
gagatgacacccgtgcagcgccgcatcgagcctcggtctgctgacgactcgctctccggt
gttgtgcgctgcctctacttcgctgacacgttccttcgagatgcgacccaccacgggccc
accatgtgggcgggcaccaactcgggctctgtgttcgcctatgcgctggaggtcccagca
gccacagcaggtggagagaagcggcctgagcaggcagtggaggctgtgctgggcaaggag
gtacaactgatgcaccgagcgcccgtggtggccattgctgtgctggacggtcgtggccgg
ccactgcctgagccctatgaggcttcccgggacctggcccaggcgccagacatgcaaggc
ggccatgctgtgctcattgcatccgaggaacaattcaaggtgttcacactgcccaaggtg
agtgctaagactaaattcaagctgacagcccatgaaggctgtcgtgtgcggaaggtagcc
ctggctacgtttgccagtgtgatgtctgaggactacactgagacctgccttgcctgcctc
accaacctgggtgacgtccatgtcttctcggtgcctggcctgaggcctcaggtgcactac
tcctgtatccggaaggaggacatcagcggcatcgcctcctgcgtcttcacacgccacggc
cagggcttttacttgatttctccatcggaatttgagcgcttctcactgagtgctcgcaac
atcacagaaccactctgttctctggatataagctggccccaaaatgccacccagcccagg
cttcaagagtcacccaagctgagccaggctaatgggaccagagacatcattctggccccg
gagagctgccaaggaagccctagctctgcccacagcaagcgagccgataccacggagcca
cccgaggctactctctcgcctgtgtccattgattcagctgctagtggggataccatgctg
gacacgacaggggatgtcaccgtggaatatgtgaaggattttctgggctctcctgaggac
tctgagaagaacctgcggaacctggaggcagatgatgcttgtcgggcctacacccttctg
attaaatga

DBGET integrated database retrieval system