KEGG   Mus pahari (shrew mouse): 110331563
Entry
110331563         CDS       T05929                                 
Symbol
Map2k4
Name
(RefSeq) dual specificity mitogen-activated protein kinase kinase 4 isoform X1
  KO
K04430  mitogen-activated protein kinase kinase 4 [EC:2.7.12.2]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04010  MAPK signaling pathway
mpah04012  ErbB signaling pathway
mpah04620  Toll-like receptor signaling pathway
mpah04664  Fc epsilon RI signaling pathway
mpah04668  TNF signaling pathway
mpah04912  GnRH signaling pathway
mpah04926  Relaxin signaling pathway
mpah04935  Growth hormone synthesis, secretion and action
mpah04936  Alcoholic liver disease
mpah05132  Salmonella infection
mpah05135  Yersinia infection
mpah05142  Chagas disease
mpah05161  Hepatitis B
mpah05166  Human T-cell leukemia virus 1 infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05169  Epstein-Barr virus infection
mpah05208  Chemical carcinogenesis - reactive oxygen species
mpah05417  Lipid and atherosclerosis
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110331563 (Map2k4)
   04012 ErbB signaling pathway
    110331563 (Map2k4)
   04668 TNF signaling pathway
    110331563 (Map2k4)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    110331563 (Map2k4)
   04664 Fc epsilon RI signaling pathway
    110331563 (Map2k4)
  09152 Endocrine system
   04912 GnRH signaling pathway
    110331563 (Map2k4)
   04926 Relaxin signaling pathway
    110331563 (Map2k4)
   04935 Growth hormone synthesis, secretion and action
    110331563 (Map2k4)
 09160 Human Diseases
  09161 Cancer: overview
   05208 Chemical carcinogenesis - reactive oxygen species
    110331563 (Map2k4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110331563 (Map2k4)
   05161 Hepatitis B
    110331563 (Map2k4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110331563 (Map2k4)
   05169 Epstein-Barr virus infection
    110331563 (Map2k4)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110331563 (Map2k4)
   05135 Yersinia infection
    110331563 (Map2k4)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110331563 (Map2k4)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110331563 (Map2k4)
   05418 Fluid shear stress and atherosclerosis
    110331563 (Map2k4)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    110331563 (Map2k4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:mpah01001]
    110331563 (Map2k4)
Enzymes [BR:mpah01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     110331563 (Map2k4)
Protein kinases [BR:mpah01001]
 Serine/threonine kinases: STE group
  STE7 family
   110331563 (Map2k4)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like Seadorna_VP7 Pkinase_fungal ABC1 Haspin_kinase APH
Other DBs
NCBI-GeneID: 110331563
NCBI-ProteinID: XP_021067933
Ensembl: MGP_PahariEiJ_G0017642
LinkDB
Position
14:complement(33618507..33725829)
AA seq 408 aa
MAAPSPSGGGGSGGGGGTPGPIGPPASGHQAVSSMQGFQINFCEKAQSKRKALKLNFANP
PVKSTARFTLNPNTTGVQNPHIERLRTHSIESSGKLKISPEQHWDFTAEDLKDLGEIGRG
AYGSVNKMVHKPSGQIMAVKRIRSTVDEKEQKQLLMDLDVVMRSSDCPYIVQFYGALFRE
GDCWICMELMSTSFDKFYKYVYSVLDDVIPEEILGKITLATVKALNHLKENLKIIHRDIK
PSNILLDRSGNIKLCDFGISGQLVDSIAKTRDAGCRPYMAPERIDPSASRQGYDVRSDVW
SLGITLYELATGRFPYPKWNSVFDQLTQVVKGDPPQLSNSEEREFSPSFINFVNLCLTKD
ESKRPKYKELLKHPFILMYEERTVEVACYVCKILDQMPATPSSPMYVD
NT seq 1227 nt   +upstreamnt  +downstreamnt
atggcggctccgagcccgagcggcggcggcggctccgggggcggtggcggcaccccgggg
cccatcggacctccagcttctggccaccaggcggtcagcagcatgcagggctttcagata
aacttctgtgaaaaggcacaaagtaagcgcaaagcactgaagttgaattttgcaaatcca
cccgtcaaatcgacagcacggtttactctgaatcctaatactacaggagtccagaaccca
cacatagagagactgagaacacacagcattgagtcatcaggaaaactgaagatctcccct
gaacaacactgggatttcactgcagaggacttgaaagaccttggagaaattggacgagga
gcttatggttctgtcaacaaaatggtccacaaaccaagtgggcagataatggcagttaaa
agaattcggtcaactgtggatgaaaaagaacaaaaacaacttctcatggatttggatgta
gtaatgcggagtagtgattgcccatacattgttcagttctatggtgcactcttcagagag
ggcgactgttggatctgtatggagctcatgtctacctcgttcgataagttttacaaatat
gtatatagtgtgttagatgacgttattccggaagagatcttaggcaaaatcactttagca
actgtgaaagcactaaaccacttaaaagaaaacttgaaaattattcacagagacatcaaa
ccttccaatattcttctggacagaagtggaaatataaaactctgtgatttcggcatcagt
ggacagcttgtggactctattgccaagacaagagatgctgggtgtaggccgtatatggca
cctgaaagaatagacccaagtgcatcaagacaagggtatgatgtccgctctgatgtctgg
agtttgggaatcacattgtacgagttggccacaggccgatttccttatccaaagtggaat
agtgtatttgatcagctaacacaagtggtgaaaggagaccctccacagctgagtaattcc
gaagaaagggagttctctcccagtttcatcaactttgtcaacttgtgccttacgaaggat
gaatccaaaaggccaaagtataaagagcttctgaaacatccctttattttgatgtatgaa
gaacgtactgtagaggtcgcatgctatgtttgtaaaatcctggatcagatgccagccact
cccagctctcccatgtatgtcgactga

DBGET integrated database retrieval system