Mus pahari (shrew mouse): 110331924 Help Entry 110331924         CDS       T05929                                  Name (RefSeq) C-C motif chemokine 2   KO K14624   C-C motif chemokine 2 Organism mpah  Mus pahari (shrew mouse) Pathway mpah04060   Cytokine-cytokine receptor interaction mpah04061   Viral protein interaction with cytokine and cytokine receptor mpah04062   Chemokine signaling pathway mpah04621   NOD-like receptor signaling pathway mpah04657   IL-17 signaling pathway mpah04668   TNF signaling pathway mpah04933   AGE-RAGE signaling pathway in diabetic complications mpah05135   Yersinia infection mpah05142   Chagas disease mpah05144   Malaria mpah05163   Human cytomegalovirus infection mpah05164   Influenza A mpah05168   Herpes simplex virus 1 infection mpah05171   Coronavirus disease - COVID-19 mpah05323   Rheumatoid arthritis mpah05417   Lipid and atherosclerosis mpah05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     110331924   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110331924    04061 Viral protein interaction with cytokine and cytokine receptor     110331924  09150 Organismal Systems   09151 Immune system    04621 NOD-like receptor signaling pathway     110331924    04657 IL-17 signaling pathway     110331924    04062 Chemokine signaling pathway     110331924  09160 Human Diseases   09172 Infectious disease: viral    05171 Coronavirus disease - COVID-19     110331924    05164 Influenza A     110331924    05168 Herpes simplex virus 1 infection     110331924    05163 Human cytomegalovirus infection     110331924   09171 Infectious disease: bacterial    05135 Yersinia infection     110331924   09174 Infectious disease: parasitic    05144 Malaria     110331924    05142 Chagas disease     110331924   09163 Immune disease    05323 Rheumatoid arthritis     110331924   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110331924    05418 Fluid shear stress and atherosclerosis     110331924   09167 Endocrine and metabolic disease    04933 AGE-RAGE signaling pathway in diabetic complications     110331924  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpah04052]     110331924    00536 Glycosaminoglycan binding proteins [BR:mpah00536]     110331924 Cytokines and neuropeptides [BR:mpah04052]  Cytokines   Chemokines    110331924 Glycosaminoglycan binding proteins [BR:mpah00536]  Heparan sulfate / Heparin   Chemokines    110331924 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 bHLH_ILI Motif Other DBs NCBI-GeneID:  110331924 NCBI-ProteinID:  XP_021068453 Ensembl:  MGP_PahariEiJ_G0017984 LinkDB All DBs Position 14:49785660..49787450 Genome browser AA seq 148 aa AA seqDB search MQVPATLLGTLFTVAIWSIHVLAQPDAVNAPLTCCYSFTSKMIPMSRLESYKRITSSRCP KEAVVFVTKLKREVCADPKKEWVQTYIKNLDQNQMRSETTTLFKTAYTLRSSAPLNVKLT RKSEANVSTTFSTTTSSTAVGVTSVTVN NT seq 447 nt NT seq  +upstreamnt  +downstreamnt atgcaggtccctgccacgcttctgggcacgctgttcacagttgccatctggagcatccac gtgctggctcagccagatgcagttaatgccccactcacttgctgctactcattcaccagc aagatgatcccaatgagtaggctggagagctacaagagaatcaccagcagcagatgtccc aaagaagctgtcgtttttgtcaccaagctcaagagagaggtctgtgctgaccccaagaag gaatgggtccagacatacattaaaaacctggaccagaaccaaatgagatcagaaactaca actttatttaaaactgcatataccctaaggtcttcagcacctttgaatgtgaagttgacc cgtaaatctgaagctaatgtatccactactttttccacaaccacctcaagcactgctgta ggagtgaccagtgtgacagtgaactag

DBGET integrated database retrieval system