KEGG   Mus pahari (shrew mouse): 110332215
Entry
110332215         CDS       T05929                                 
Symbol
Pdcd1lg2
Name
(RefSeq) programmed cell death 1 ligand 2
  KO
K06708  programmed cell death 1 ligand 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110332215 (Pdcd1lg2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110332215 (Pdcd1lg2)
CD molecules [BR:mpah04090]
 Proteins
  110332215 (Pdcd1lg2)
SSDB
Motif
Pfam: Ig_3 Ig_2 I-set C2-set_2 ig C1-set V-set
Other DBs
NCBI-GeneID: 110332215
NCBI-ProteinID: XP_021069009
LinkDB
Position
1:141002912..141037125
AA seq 299 aa
MEIDTDHDAPAADTEPELATSSCGRPIITVLLIMDLNTNCVSLAALFTVTAPKEVYTVDF
GSSVSLECNFDRRECTELEGLRASLQKVENDTSPQSERATLLEEQLPLGKALFHIPSVQV
RDSGQYRCLVICGAAWDYKYLTVKVKASYMRIDTRILEVPGTEEVQLTCQARGYPLAEVS
WQNVSVPANTSHIRTPEGLYQVTSVLRLKPQPNRNFSCMFWNAHMKELTSAIIDPSGMEP
KVPRSWPLHAFIPACAVTLIFLTIVIVQRKRIWGKLYDRKRLVQLPDAIMKFLCAVDCG
NT seq 900 nt   +upstreamnt  +downstreamnt
atggagattgacacagaccatgatgctcctgctgccgatactgaacctgagcttgcaact
tcatcatgtggcagaccaatcatcacagttctcctaataatggatctaaacactaactgt
gtctcccttgcagctttattcacggtgacagcccctaaagaagtgtacacggtagacttc
ggcagcagtgtgagcctggagtgcaattttgaccgcagagaatgcactgaactggaaggg
ctaagagccagtttgcagaaggtagaaaacgatacttctccgcaaagtgaaagagccacc
ctgctggaggagcagctgcccctgggaaaggctttgttccacatccccagtgtccaagtg
agagattccgggcagtaccgttgcctggtcatctgcggggccgcctgggactacaagtac
ctgacagtgaaagtcaaagcttcttacatgaggatagacactaggatcctggaggttcca
gggacagaggaggtgcagctcacctgccaggctagaggttatcccctagcagaagtgtcc
tggcaaaatgtcagtgttcctgccaacaccagccacatcaggacccctgaaggcctctac
caggtcaccagtgttctgcgcctaaagccacagcctaacagaaacttcagctgcatgttc
tggaatgctcacatgaaggagctgacttcagccatcattgacccaagtgggatggaaccc
aaagtccccagatcttggccacttcatgctttcatcccagcctgcgccgtcactttgatc
ttcctaacaatagtgatagtgcagagaaagaggatctgggggaagctgtatgacagaaaa
agattagtgcagctcccagatgccatcatgaagtttctttgtgcagtggactgtggttag

DBGET integrated database retrieval system