Mus pahari (shrew mouse): 110332246 Help Entry 110332246         CDS       T05929                                  Name (RefSeq) C-C motif chemokine 3   KO K05408   C-C motif chemokine 3 Organism mpah  Mus pahari (shrew mouse) Pathway mpah04060   Cytokine-cytokine receptor interaction mpah04061   Viral protein interaction with cytokine and cytokine receptor mpah04062   Chemokine signaling pathway mpah04620   Toll-like receptor signaling pathway mpah05142   Chagas disease mpah05163   Human cytomegalovirus infection mpah05323   Rheumatoid arthritis mpah05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110332246    04061 Viral protein interaction with cytokine and cytokine receptor     110332246  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     110332246    04062 Chemokine signaling pathway     110332246  09160 Human Diseases   09172 Infectious disease: viral    05163 Human cytomegalovirus infection     110332246   09174 Infectious disease: parasitic    05142 Chagas disease     110332246   09163 Immune disease    05323 Rheumatoid arthritis     110332246   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110332246  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpah04052]     110332246    00536 Glycosaminoglycan binding proteins [BR:mpah00536]     110332246 Cytokines and neuropeptides [BR:mpah04052]  Cytokines   Chemokines    110332246 Glycosaminoglycan binding proteins [BR:mpah00536]  Heparan sulfate / Heparin   Chemokines    110332246 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  110332246 NCBI-ProteinID:  XP_021069016 Ensembl:  MGP_PahariEiJ_G0018012 LinkDB All DBs Position 14:complement(51283538..51285087) Genome browser AA seq 92 aa AA seqDB search MKVSTAALAVFLCTMTLCNQVFSAPYGADTPTACCFSYGRKISRQFIVDYFETSSLCSQP GVIFLTKRNRQFCADPKETWVQEYITDLELNA NT seq 279 nt NT seq  +upstreamnt  +downstreamnt atgaaggtctccaccgctgcccttgctgtttttctgtgtaccatgacactctgcaaccaa gtcttctcagcgccatatggagctgacaccccgactgcctgctgcttctcctacggccgg aagatttcacgccaattcatcgttgactattttgagaccagcagcctttgctcccagcca ggtgtcattttcctaaccaagagaaaccggcagttctgcgctgaccccaaagagacctgg gtccaagaatatatcactgacctggaactgaatgcctga

DBGET integrated database retrieval system