KEGG   Mus pahari (shrew mouse): 110332367
Entry
110332367         CDS       T05929                                 
Symbol
Icam2
Name
(RefSeq) intercellular adhesion molecule 2
  KO
K06523  intercellular adhesion molecule 2
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04650  Natural killer cell mediated cytotoxicity
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110332367 (Icam2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110332367 (Icam2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110332367 (Icam2)
   04091 Lectins [BR:mpah04091]
    110332367 (Icam2)
CD molecules [BR:mpah04090]
 Proteins
  110332367 (Icam2)
Lectins [BR:mpah04091]
 I-type lectins (Siglecs)
  110332367 (Icam2)
SSDB
Motif
Pfam: ICAM_N Ig_2 ig DUF3377 Ig_3 Adhes-Ig_like
Other DBs
NCBI-GeneID: 110332367
NCBI-ProteinID: XP_021069212
Ensembl: MGP_PahariEiJ_G0018453
LinkDB
Position
14:complement(73682839..73694434)
AA seq 279 aa
MSSFACWSLSITLLVLFYSPGSGERAFEVYIWSEKQIVEATESWKINCSTSCAAPDMGGL
ETSMNKIMLEEHPQGKWKQFLISNVSKDTVFLCHFTCSGKQHSESLNISVYQPPAQVTLK
LQPPRVIVGETFTVECKVSPVKPLEWLTLSLLRGRETLKSQTFGGAETDPQEATATFNST
ALKKDGLNFSCQAELDLRPHGGYIIRSISEYQILEVYEPMQDNQMVIIIVVVSLLLFLFV
TSVLLCFIFGQHWHRRRTGTYGVLAAWRRLPRAFRTRSV
NT seq 840 nt   +upstreamnt  +downstreamnt
atgtcttcttttgcttgctggagcctgtctataacccttcttgtcctgttctacagccca
gggtccggcgagagggcctttgaggtctacatatggtctgagaagcagatagttgaagcc
acagagtcttggaaaatcaactgcagcaccagctgtgccgccccagatatgggtggtctg
gagacgtccatgaataaaataatgttggaagagcatcctcaagggaagtggaaacagttc
ttaatctcaaatgtctccaaagacacggtctttctttgccatttcacctgttcgggaaag
cagcactcggagagtctcaacatcagcgtgtaccagcctccagctcaagtcacactgaag
ttgcagcccccccgggtgattgtgggtgaaaccttcaccgttgagtgcaaggtgtcccct
gtgaagccccttgagtggctcaccctctctctgctccgtggcagagagaccctgaagagt
cagacctttgggggagcagaaactgacccccaagaggccacagccacgttcaacagcaca
gctctgaaaaaggacggtctcaacttttcctgccaggctgaactggatctacggccccat
ggtgggtatatcatccgcagcatctcggagtaccagatccttgaagtctatgagccgatg
caggacaaccaaatggtcatcatcatcgtagtggtgtcactactgctgttcttatttgtg
acatctgtcctgctgtgctttatctttggccagcactggcacagaagacggacaggcacc
tacggggtgctagctgcctggaggaggttgccccgagccttccggacacgttccgtgtga

DBGET integrated database retrieval system