Mus pahari (shrew mouse): 110332476 Help Entry 110332476         CDS       T05929                                  Symbol Ccl5 Name (RefSeq) C-C motif chemokine 5   KO K12499   C-C motif chemokine 5 Organism mpah  Mus pahari (shrew mouse) Pathway mpah04060   Cytokine-cytokine receptor interaction mpah04061   Viral protein interaction with cytokine and cytokine receptor mpah04062   Chemokine signaling pathway mpah04620   Toll-like receptor signaling pathway mpah04621   NOD-like receptor signaling pathway mpah04623   Cytosolic DNA-sensing pathway mpah04668   TNF signaling pathway mpah05020   Prion disease mpah05142   Chagas disease mpah05163   Human cytomegalovirus infection mpah05164   Influenza A mpah05168   Herpes simplex virus 1 infection mpah05323   Rheumatoid arthritis mpah05417   Lipid and atherosclerosis Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04668 TNF signaling pathway     110332476 (Ccl5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110332476 (Ccl5)    04061 Viral protein interaction with cytokine and cytokine receptor     110332476 (Ccl5)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     110332476 (Ccl5)    04621 NOD-like receptor signaling pathway     110332476 (Ccl5)    04623 Cytosolic DNA-sensing pathway     110332476 (Ccl5)    04062 Chemokine signaling pathway     110332476 (Ccl5)  09160 Human Diseases   09172 Infectious disease: viral    05164 Influenza A     110332476 (Ccl5)    05168 Herpes simplex virus 1 infection     110332476 (Ccl5)    05163 Human cytomegalovirus infection     110332476 (Ccl5)   09174 Infectious disease: parasitic    05142 Chagas disease     110332476 (Ccl5)   09163 Immune disease    05323 Rheumatoid arthritis     110332476 (Ccl5)   09164 Neurodegenerative disease    05020 Prion disease     110332476 (Ccl5)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110332476 (Ccl5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpah04052]     110332476 (Ccl5)    00536 Glycosaminoglycan binding proteins [BR:mpah00536]     110332476 (Ccl5) Cytokines and neuropeptides [BR:mpah04052]  Cytokines   Chemokines    110332476 (Ccl5) Glycosaminoglycan binding proteins [BR:mpah00536]  Heparan sulfate / Heparin   Chemokines    110332476 (Ccl5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 Motif Other DBs NCBI-GeneID:  110332476 NCBI-ProteinID:  XP_021069386 Ensembl:  MGP_PahariEiJ_G0018009 LinkDB All DBs Position 14:complement(51157331..51161418) Genome browser AA seq 91 aa AA seqDB search MKISAAALTIILTAAALCTPAPASPYGSDTTPCCFAYISLALPRAHVKEYFYTSSKCSNL AVVFVTRRNRQVCANPEKAWVQEYINYLEMS NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaagatctctgcagctgccctgaccatcatcctcactgcggccgccctctgcacccct gcacctgcctccccatatggctcagacaccactccctgctgctttgcctacatctccctc gcgctgccacgtgcccatgtcaaggagtatttctacaccagcagcaagtgctccaacctt gcagtcgtgtttgtcactcgaaggaaccgtcaagtgtgtgccaacccagagaaggcatgg gttcaagaatacatcaactatttggagatgagctag

DBGET integrated database retrieval system