KEGG   Mus pahari (shrew mouse): 110332557
Entry
110332557         CDS       T05929                                 

Gene name
Nr1d1
Definition
(RefSeq) nuclear receptor subfamily 1 group D member 1
  KO
K03728  nuclear receptor subfamily 1 group D member 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04710  Circadian rhythm
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09159 Environmental adaptation
   04710 Circadian rhythm
    110332557 (Nr1d1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:mpah03000]
    110332557 (Nr1d1)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:mpah03310]
    110332557 (Nr1d1)
Transcription factors [BR:mpah03000]
 Eukaryotic type
  Zinc finger
   Cys4 thyroid hormone receptor-like
    110332557 (Nr1d1)
Nuclear receptors [BR:mpah03310]
 1. Thyroid hormone like
  1D. Rev-Erb
   110332557 (Nr1d1)
SSDB
Motif
Pfam: zf-C4 Hormone_recep
Other DBs
NCBI-GeneID: 110332557
NCBI-ProteinID: XP_021069484
Ensembl: MGP_PahariEiJ_G0018226
LinkDB
Position
14
AA seq 616 aa
MTTLDSNNNTGGVITYIGSSGSSPSRTSPESLYSDSSNGSFQSLTQGCPTYFPPSPTGSL
TQDPARSFGSVPPSLNDDSSPSSASSSSSSSSSSSFYNGSPPGSLQVAMEDSSRVSPSKG
TSNITKLNGMVLLCKVCGDVASGFHYGVHACEGCKGFFRRSIQQNIQYKRCLKNENCSIV
RINRNRCQQCRFKKCLSVGMSRDAVRFGRIPKREKQRMLAEMQSAMNLANNQLSSLCPLE
TSSTPHPTSGSMGPSPPPAPAPTPLVGFSQFPQQLTPPRSPSPEPTVEDVISQVARAHRE
IFTYAHDKLGTSPGNFNANHASGSPSATTPHRWESQGCPSAPNDNSLLAAQRHNEALNGL
RQGPSSYPPTWPSGSTHHSCHQPNSNGHRLCPTHVYSAPEGEAPANSLRQGNTKNVLLAC
PMNMYPHGRSGRTVQEIWEDFSMSFTPAVREVVEFAKHIPGFRDLSQHDQVTLLKAGTFE
VLMVRFASLFNVKDQTVMFLSRTTYSLQELGAMGMGDLLNAMFDFSEKLNSLALTEEELG
LFTAVVLVSADRSGMENSASVEQLQETLLRALRALVLKNRPSETSRFTKLLLKLPDLRTL
NNMHSEKLLSFRVDAQ
NT seq 1851 nt   +upstreamnt  +downstreamnt
atgacgaccctggactccaacaacaacacaggcggtgttatcacctacattggctctagt
ggttcctcccccagcaggaccagcccggagtccctctacagtgacagctccaatggcagc
ttccagtccctgactcaaggttgtcctacatacttcccaccatcacccactggctccctc
acccaggaccctgcccgctcttttggcagtgtgccacccagtctcaatgatgatagctcc
ccttcttctgcatcatcgtcatcctcttcatcctcctcctcctccttctataatgggagc
cccccaggaagtctacaagtggccatggaagacagcagccgagtgtcccccagcaagggc
acgagcaacattaccaagctgaatggcatggtgctactgtgtaaggtgtgtggagacgtg
gcctcaggcttccactacggtgtgcatgcctgtgagggctgcaagggcttttttcgccgg
agcatccaacagaatatccagtacaaacggtgtctgaaaaacgagaactgctccatcgtt
cgcatcaatcgcaaccgctgccagcagtgtcgcttcaagaagtgtctctccgttggcatg
tctagagatgctgtgcgttttgggcgcatccccaagagagagaagcaacggatgcttgcg
gagatgcagagcgccatgaacttggccaacaaccaactgagcagcctgtgccctctagag
acctcgtctactccgcaccccacctccggctccatgggcccctcacctcctcctgcacca
gcccctacacctttggtgggcttctctcagttcccacaacagctgacaccacccaggtcc
cccagccctgagcccaccgtggaggatgtgatatcccaggtggcccgggcccatcgagaa
atctttacctatgcccatgacaagttaggcacctcacctggcaacttcaatgccaatcac
gcatcgggtagcccttcagctacaactccacaccgctgggagagtcagggatgcccgtct
gcccccaatgacaacagcctcttggcagctcagcgtcacaatgaagcgctgaatggtcta
cgccagggtccctcctcctaccctcctacctggccttctggctccacccaccacagctgc
caccaacctaacagcaatgggcaccgtctgtgccccacccacgtatattcggccccagaa
ggggaggcacctgccaacagtctacggcaaggcaacaccaagaatgttctgctggcatgt
cccatgaacatgtatccccatggacgcagcggccggaccgtgcaggagatctgggaagac
ttctctatgagcttcacgcctgccgtgcgggaggtggtagagtttgccaaacacatccca
ggcttccgtgacctttctcagcatgaccaggtgaccctgcttaaggccggcacctttgag
gtgctgatggtgcgctttgcatcgttgttcaacgtgaaggaccagacagtgatgttcctg
agccgcacaacctacagtctgcaggaactcggtgccatgggcatgggcgacctgctcaat
gccatgtttgacttcagtgagaagctcaactccctggcgcttaccgaggaggagctgggc
ctattcaccgcggtggtgctcgtctctgcagaccgctcgggaatggagaattccgcttcg
gtggagcagctccaggagacgctgctgcgggctcttcgggctctggtgctgaagaaccgg
ccctcggagacttcccgcttcaccaagctgctgctcaagctgccggacctgcggaccctg
aacaacatgcattccgagaagctgctgtccttccgggtggacgcccagtga

DBGET integrated database retrieval system