Mus pahari (shrew mouse): 110332614 Help Entry 110332614         CDS       T05929                                  Symbol Il5 Name (RefSeq) interleukin-5   KO K05428   interleukin 5 Organism mpah  Mus pahari (shrew mouse) Pathway mpah04060   Cytokine-cytokine receptor interaction mpah04630   JAK-STAT signaling pathway mpah04640   Hematopoietic cell lineage mpah04657   IL-17 signaling pathway mpah04658   Th1 and Th2 cell differentiation mpah04660   T cell receptor signaling pathway mpah04664   Fc epsilon RI signaling pathway mpah04672   Intestinal immune network for IgA production mpah05200   Pathways in cancer mpah05310   Asthma mpah05320   Autoimmune thyroid disease mpah05321   Inflammatory bowel disease mpah05330   Allograft rejection Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04630 JAK-STAT signaling pathway     110332614 (Il5)   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     110332614 (Il5)  09150 Organismal Systems   09151 Immune system    04640 Hematopoietic cell lineage     110332614 (Il5)    04660 T cell receptor signaling pathway     110332614 (Il5)    04658 Th1 and Th2 cell differentiation     110332614 (Il5)    04657 IL-17 signaling pathway     110332614 (Il5)    04664 Fc epsilon RI signaling pathway     110332614 (Il5)    04672 Intestinal immune network for IgA production     110332614 (Il5)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110332614 (Il5)   09163 Immune disease    05310 Asthma     110332614 (Il5)    05320 Autoimmune thyroid disease     110332614 (Il5)    05321 Inflammatory bowel disease     110332614 (Il5)    05330 Allograft rejection     110332614 (Il5)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpah04052]     110332614 (Il5)    00536 Glycosaminoglycan binding proteins [BR:mpah00536]     110332614 (Il5) Cytokines and neuropeptides [BR:mpah04052]  Cytokines   Interleukins    110332614 (Il5) Glycosaminoglycan binding proteins [BR:mpah00536]  Heparan sulfate / Heparin   Cytokines    110332614 (Il5) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL5 Motif Other DBs NCBI-GeneID:  110332614 NCBI-ProteinID:  XP_021069557 Ensembl:  MGP_PahariEiJ_G0017479 LinkDB All DBs Position 14:21764833..21769749 Genome browser AA seq 132 aa AA seqDB search MRMLLHLSVLTLSCVWTTAMEIPMSTVVKETLTQLSAHQALLTSNETMRLPVPTHKNHQL CIGEIFQGLDILKNQTVRGGTVEMLFQNLSLIKKYIDRQKEKCVEERRRTKQFLDYLQEF LGVMSTEWAMEG NT seq 399 nt NT seq  +upstreamnt  +downstreamnt atgaggatgcttctgcacttgagcgttctgactctgagctgtgtctggaccactgccatg gagattcccatgagcacagtggtgaaagagaccttgacacaactgtccgctcaccaagct ctgctgacaagcaacgagacgatgaggcttcctgtgcctactcataaaaatcaccagcta tgcattggagaaatctttcaggggctagacatactgaagaatcaaactgtccgcgggggt actgtggaaatgctattccaaaacttgtcattaataaagaaatacattgaccgccaaaaa gagaagtgtgttgaggagagacggaggacgaagcagttcctggattacctacaagagttc cttggtgtgatgagtacagagtgggcaatggaaggctaa

DBGET integrated database retrieval system