KEGG   Mus pahari (shrew mouse): 110332797
Entry
110332797         CDS       T05929                                 

Gene name
Fas
Definition
(RefSeq) tumor necrosis factor receptor superfamily member 6
  KO
K04390  tumor necrosis factor receptor superfamily member 6
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01524  Platinum drug resistance
mpah04010  MAPK signaling pathway
mpah04060  Cytokine-cytokine receptor interaction
mpah04115  p53 signaling pathway
mpah04210  Apoptosis
mpah04217  Necroptosis
mpah04650  Natural killer cell mediated cytotoxicity
mpah04668  TNF signaling pathway
mpah04932  Non-alcoholic fatty liver disease
mpah04940  Type I diabetes mellitus
mpah05010  Alzheimer disease
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05142  Chagas disease
mpah05143  African trypanosomiasis
mpah05160  Hepatitis C
mpah05161  Hepatitis B
mpah05162  Measles
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
mpah05205  Proteoglycans in cancer
mpah05320  Autoimmune thyroid disease
mpah05330  Allograft rejection
mpah05332  Graft-versus-host disease
mpah05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    110332797 (Fas)
   04668 TNF signaling pathway
    110332797 (Fas)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    110332797 (Fas)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110332797 (Fas)
   04217 Necroptosis
    110332797 (Fas)
   04115 p53 signaling pathway
    110332797 (Fas)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    110332797 (Fas)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110332797 (Fas)
   05205 Proteoglycans in cancer
    110332797 (Fas)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110332797 (Fas)
   05161 Hepatitis B
    110332797 (Fas)
   05160 Hepatitis C
    110332797 (Fas)
   05164 Influenza A
    110332797 (Fas)
   05162 Measles
    110332797 (Fas)
   05168 Herpes simplex virus 1 infection
    110332797 (Fas)
   05163 Human cytomegalovirus infection
    110332797 (Fas)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110332797 (Fas)
   05169 Epstein-Barr virus infection
    110332797 (Fas)
   05165 Human papillomavirus infection
    110332797 (Fas)
  09174 Infectious disease: parasitic
   05142 Chagas disease
    110332797 (Fas)
   05143 African trypanosomiasis
    110332797 (Fas)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    110332797 (Fas)
   05330 Allograft rejection
    110332797 (Fas)
   05332 Graft-versus-host disease
    110332797 (Fas)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    110332797 (Fas)
   05022 Pathways of neurodegeneration - multiple diseases
    110332797 (Fas)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    110332797 (Fas)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    110332797 (Fas)
   04932 Non-alcoholic fatty liver disease
    110332797 (Fas)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110332797 (Fas)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04050 Cytokine receptors [BR:mpah04050]
    110332797 (Fas)
   04090 CD molecules [BR:mpah04090]
    110332797 (Fas)
Cytokine receptors [BR:mpah04050]
 Tumor necrosis factor receptors
  TNF receptor superfamily
   110332797 (Fas)
CD molecules [BR:mpah04090]
 Proteins
  110332797 (Fas)
SSDB
Motif
Pfam: Death TNFR_c6 DUF6377
Other DBs
NCBI-GeneID: 110332797
NCBI-ProteinID: XP_021069812
LinkDB
Position
1
AA seq 345 aa
MKPAHSPPCLEPIGRKQISDDPIIPQGHQLFGFDGSSVTLHFCTFLLQAKVLIPFTIEIF
RMDSVLAGSQLSVHTQDTDSISEGLKLRRRVRETDNCTEGLYRGGPFCCQPCQPGRSHEA
SRDEREKQGLQVETNCTPTQDTKCKCKPDFYCDSSGCEHCVRCASCEHGTLEPCTATSNT
KCREQSSRNHLWFLTILVLPVLLAFIYLYIKYQKRHRDDPESRIPSHETIPMNVSNLSLS
KYIPRIAEEMKIHEVRKFARENKIKESRIDEIKHDSIHDTAEQKIQLLQCWYQSHGKSGA
YQDLIKGLKKAKCRKVVDKFQAMVQKDLENSTSDIGNENEGQLLE
NT seq 1038 nt   +upstreamnt  +downstreamnt
atgaaaccagctcactctcctccatgcctagagcccattggacggaaacagatatcggat
gaccctatcattcctcaagggcaccagctcttcggcttcgatggctcgtcagtgacttta
catttctgtactttcctcctgcaagccaaggttctgattccattcacaatagagatattt
cggatggattccgtgcttgctggctcacagttaagtgttcatactcaagatactgatagc
atctctgagggtttaaagttgaggaggagggttcgtgaaactgacaactgcacagaagga
ttatatcgagggggcccattttgctgtcaaccatgccaacctggtaggtcacatgaagca
tccagagatgagcgtgagaagcagggtttacaagtggaaacaaactgcaccccgacccag
gataccaagtgcaagtgcaaaccagacttctactgtgattcttctggctgcgaacactgt
gttcgctgcgcctcgtgtgaacatggaacgcttgagccatgtacagcaaccagcaatacc
aaatgcagggaacaaagttccagaaatcacctatggtttttgaccatccttgttttgcca
gtactacttgcatttatatatctttatataaagtaccagaaaagacatcgtgatgatcct
gaatctagaatcccaagtcacgaaaccataccaatgaatgtctcaaatcttagcttgagt
aaatacatcccaaggattgccgaagaaatgaaaatccatgaagttagaaaatttgctcga
gaaaataagatcaaggaaagcaggatagatgagatcaagcatgacagcatccatgacaca
gctgagcagaaaatccaactgctccaatgctggtaccaatctcacgggaagagtggtgca
tatcaagatttaatcaagggtctcaaaaaagccaaatgtcgcaaagttgtagataaattt
caggccatggtccagaaggaccttgaaaactcaacctcagacatcggaaatgaaaatgaa
ggacaacttctggagtga

DBGET integrated database retrieval system