KEGG   Mus pahari (shrew mouse): 110333295
Entry
110333295         CDS       T05929                                 
Symbol
Cd226
Name
(RefSeq) CD226 antigen isoform X1
  KO
K06567  CD226 antigen
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110333295 (Cd226)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110333295 (Cd226)
CD molecules [BR:mpah04090]
 Proteins
  110333295 (Cd226)
SSDB
Motif
Pfam: V-set Ig_3 Ig_2 ig I-set stn_TNFRSF12A LAX DUF4064 TMEM154 DUF6377 DUF6479 DeoC Syndecan Adeno_E3_CR2
Other DBs
NCBI-GeneID: 110333295
NCBI-ProteinID: XP_021070539
Ensembl: MGP_PahariEiJ_G0019188
LinkDB
Position
15:81400047..81475625
AA seq 333 aa
MAYLTWLLAILHVHKALCEETLWDTTVRLSETMTLECVYPLTHNLTQVEWTKNIGTKTVS
IAVYNPNHNMHIEPNYLHRVHFLNSTVGFRNMSLSFYNASEADIGTYSCLFHAFPGGPWE
KKIKVVSSESFEIAAPSDSYLSAEPGQDVTLNCQLQRTWSAQQVIWEKVQAHQVDILASC
NLSQETRYTSKYLRQTRSHCSQGDMKSVLVIPNAVAADSGLYRCRSEAITGKNKTFVIRL
IITDGGTNKHFILPIVGGLISLLLVILIIVVFILYNRKRRRQVRTPLKEPRDKQSKVAAN
CRSPTSPIQSTDDEKEDIYVNYPTFSQRPKPRF
NT seq 1002 nt   +upstreamnt  +downstreamnt
atggcttatcttacttggcttttggctattcttcatgtgcacaaagcactgtgtgaagag
acattgtgggacacaactgttcggctttctgagactatgactctggaatgtgtatatcca
ttgacgcataatttaacccaggtggagtggaccaagaacattggcacaaagacagtgagc
atagctgtttacaaccctaaccataatatgcatatagagcctaactacctccatagagtg
cattttctaaactcaacagtggggttccgcaacatgagcctttccttttacaatgcctct
gaagcagacattggcacctactcctgcttgtttcatgctttcccaggtggaccttgggaa
aagaagataaaagtagtctcgtcagagagttttgagatagcagcaccctcggatagctac
ctgtctgcagaacctggacaagatgtcacactcaattgccagcttcaaaggacttggtca
gctcaacaagtcatatgggaaaaagtccaagcccatcaggtagacatcttagcttcctgt
aacctatctcaagagacaagatacacttcaaagtacctaagacaaacaaggagccactgt
agccagggggacatgaagagtgtcctcgtcattccaaatgccgtggccgctgactcagga
ctttacagatgccgttcagaggccattacaggaaaaaacaaaacctttgtcataaggctg
atcataactgatggtggaaccaataaacattttatccttcccatcgttggagggttaatt
tcactgttacttgtcatcctaattatcgtcgttttcattttatataacaggaagagacgg
agacaggtgagaactccacttaaagagcccagggataaacagagtaaagtagccgccaac
tgcagaagtcctacttctcccatccagtctacagatgatgaaaaagaggacatttatgta
aactatccaactttctctcaaagaccaaaaccaagattctaa

DBGET integrated database retrieval system