KEGG   Mus pahari (shrew mouse): 110333316
Entry
110333316         CDS       T05929                                 
Symbol
Proc
Name
(RefSeq) vitamin K-dependent protein C isoform X1
  KO
K01344  protein C (activated) [EC:3.4.21.69]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110333316 (Proc)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110333316 (Proc)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.69  protein C (activated)
     110333316 (Proc)
Peptidases and inhibitors [BR:mpah01002]
 Serine peptidases
  Family S1: chymotrypsin family
   110333316 (Proc)
SSDB
Motif
Pfam: Trypsin Gla FXa_inhibition DUF1986 EGF Trypsin_2 hEGF cEGF EGF_2
Other DBs
NCBI-GeneID: 110333316
NCBI-ProteinID: XP_021070557
Ensembl: MGP_PahariEiJ_G0018807
LinkDB
Position
15:complement(27371755..27388646)
AA seq 481 aa
MAVSGRNCSFSLAHACVSSSKMWQFRVFLLLMITWGISSILAHPDPVFSSSEHAHQVLRV
RRANSFLEEMRPGSLERECMEEICDFEEAQEIFQNVEETLAFWIKYFDGDQCSAPPLDHQ
CDSPCCGHGTCIDGMSSFSCSCDKGWEGKFCQQELRFQDCRVNNGGCLHYCLEESNGRRC
ACAPGYELADDHMHCKSIVNFPCGKLGRRMEKKRKTLKRDTDPEDELEPDPRIVNGTLTK
QGDSPWQAILLDSKKKLACGGVLIHASWVLTAAHCVESTKKLTVRLGEYDLRRRDHWELD
LDIKEILVHPNYTRSSSDNDIALLHLAQPATLSKTIVPVCLPNNGLAQELTQAGQETVVT
GWGYQSDRVKDGRRNRTFILTFIRIPLVARNECVEVMENVISENMLCAGIIGDTRDACDG
DSGGPMVVFFRGTWFLVGLVSWGEGCGHINNYGVYTKVGNYLKWIHSYTGEKDASLKSQN
L
NT seq 1446 nt   +upstreamnt  +downstreamnt
atggcggtatccggacgaaattgcagtttctccttggctcacgcctgtgtcagcagctcc
aagatgtggcaattcagagtcttcctgctgctcatgatcacctggggaatttctagcata
ctagcccatcccgacccagtgttctccagcagcgagcacgcccaccaggtacttcgggtc
agacgtgccaacagcttcctggaggagatgcggccaggcagcctggaacgggagtgtatg
gaggagatctgtgacttcgaggaggctcaggagattttccaaaatgtggaagaaacactg
gccttctggatcaagtacttcgacggtgaccagtgctcggctccgcccttggaccaccaa
tgcgacagcccatgctgcgggcatggcacatgcatcgacggcatgagcagcttcagctgc
agctgcgataagggctgggagggcaagttctgtcagcaggagctgcgtttccaggactgt
cgagtgaacaatggtggctgcttgcactactgcctggaggagagcaatgggaggcgctgc
gcttgtgccccgggctatgagctggcagatgaccacatgcactgcaagtccattgtgaat
tttccatgtgggaaactggggaggcggatggagaagaaacgcaagaccctcaaacgggac
acagacccagaagatgaactagaaccagacccaaggatagtcaatggaacgctgacgaag
cagggtgacagtccttggcaggcgatccttctggactccaagaagaagctggcctgtgga
ggggtacttatccacgcctcctgggtgctgacggcagcccactgcgtggagagcaccaag
aagcttaccgtgaggctaggtgaatatgatctgcgacgcagggaccactgggaactggac
ctggacatcaaggagatcctcgtccaccctaactatacccggagcagcagtgacaatgac
attgcactgctccacctggcccagccagccactctctccaaaaccatagtgcccgtctgc
ctaccgaacaatggcctagcacaggagctcactcaggctggccaggagacggtggtgaca
ggctggggctatcaaagcgacagagtcaaggatggcagaaggaaccgcaccttcatcctc
accttcatccgcatccctttggttgctcgaaatgagtgcgtggaggtcatggagaatgtg
atctccgagaacatgctgtgtgcaggcatcattggggacacgagagacgcctgtgatggt
gacagtggggggcccatggtggtcttctttcggggcacctggttcctggtgggcctggtg
agctggggtgagggctgtgggcacatcaacaactatggtgtctacaccaaagtgggcaac
tacctcaaatggattcacagctacactggggaaaaggatgcctcccttaagagccagaac
ctgtag

DBGET integrated database retrieval system