Mus pahari (shrew mouse): 110333420 Help Entry 110333420         CDS       T05929                                  Name (RefSeq) insulin-1   KO K04526   insulin Organism mpah  Mus pahari (shrew mouse) Pathway mpah04010   MAPK signaling pathway mpah04014   Ras signaling pathway mpah04015   Rap1 signaling pathway mpah04022   cGMP-PKG signaling pathway mpah04066   HIF-1 signaling pathway mpah04068   FoxO signaling pathway mpah04072   Phospholipase D signaling pathway mpah04081   Hormone signaling mpah04114   Oocyte meiosis mpah04140   Autophagy - animal mpah04150   mTOR signaling pathway mpah04151   PI3K-Akt signaling pathway mpah04152   AMPK signaling pathway mpah04211   Longevity regulating pathway mpah04213   Longevity regulating pathway - multiple species mpah04810   Regulation of actin cytoskeleton mpah04910   Insulin signaling pathway mpah04911   Insulin secretion mpah04913   Ovarian steroidogenesis mpah04914   Progesterone-mediated oocyte maturation mpah04917   Prolactin signaling pathway mpah04923   Regulation of lipolysis in adipocytes mpah04930   Type II diabetes mellitus mpah04931   Insulin resistance mpah04932   Non-alcoholic fatty liver disease mpah04940   Type I diabetes mellitus mpah04950   Maturity onset diabetes of the young mpah04960   Aldosterone-regulated sodium reabsorption mpah05010   Alzheimer disease mpah05215   Prostate cancer mpah05415   Diabetic cardiomyopathy Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     110333420    04014 Ras signaling pathway     110333420    04015 Rap1 signaling pathway     110333420    04066 HIF-1 signaling pathway     110333420    04068 FoxO signaling pathway     110333420    04072 Phospholipase D signaling pathway     110333420    04022 cGMP-PKG signaling pathway     110333420    04151 PI3K-Akt signaling pathway     110333420    04152 AMPK signaling pathway     110333420    04150 mTOR signaling pathway     110333420   09133 Signaling molecules and interaction    04081 Hormone signaling     110333420  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     110333420   09143 Cell growth and death    04114 Oocyte meiosis     110333420   09142 Cell motility    04810 Regulation of actin cytoskeleton     110333420  09150 Organismal Systems   09152 Endocrine system    04911 Insulin secretion     110333420    04910 Insulin signaling pathway     110333420    04923 Regulation of lipolysis in adipocytes     110333420    04913 Ovarian steroidogenesis     110333420    04914 Progesterone-mediated oocyte maturation     110333420    04917 Prolactin signaling pathway     110333420   09155 Excretory system    04960 Aldosterone-regulated sodium reabsorption     110333420   09149 Aging    04211 Longevity regulating pathway     110333420    04213 Longevity regulating pathway - multiple species     110333420  09160 Human Diseases   09162 Cancer: specific types    05215 Prostate cancer     110333420   09164 Neurodegenerative disease    05010 Alzheimer disease     110333420   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     110333420   09167 Endocrine and metabolic disease    04930 Type II diabetes mellitus     110333420    04940 Type I diabetes mellitus     110333420    04950 Maturity onset diabetes of the young     110333420    04932 Non-alcoholic fatty liver disease     110333420    04931 Insulin resistance     110333420  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:mpah04052]     110333420 Cytokines and neuropeptides [BR:mpah04052]  Neuropeptides   Unclassified    110333420 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Insulin Ins_beta Motif Other DBs NCBI-GeneID:  110333420 NCBI-ProteinID:  XP_021070669 Ensembl:  MGP_PahariEiJ_G0014557 LinkDB All DBs Position 1:163425477..163426031 Genome browser AA seq 110 aa AA seqDB search MALLVRFLPLLALLALWEPNPTQAFVKQHLCGPHLVEALYLVCGERGFFYTPKSRREVED PQVEQLELGGGPGAGDLQTLALEVARQKRGIVDQCCTSICSLYQLENYCN NT seq 333 nt NT seq  +upstreamnt  +downstreamnt atggccctgttggtgcgtttcctacccctgctggccctgcttgctctctgggagcccaac cctacccaggcttttgtcaaacagcacctttgtggtccccacctggtagaggctctctac ctggtgtgtggggagcgtggcttcttctacacacccaagtcccgtcgtgaagtggaggac ccacaagtggaacaactggagctgggtggaggccccggggcaggtgaccttcagaccctg gcactagaggtggcccggcagaagcgtggcattgtggaccagtgctgcaccagcatctgt tccctctaccagctagagaactactgcaactag

DBGET integrated database retrieval system