Mus pahari (shrew mouse): 110333938 Help Entry 110333938         CDS       T05929                                  Name (RefSeq) histone H3-like   KO K11253   histone H3 Organism mpah  Mus pahari (shrew mouse) Pathway mpah04613   Neutrophil extracellular trap formation mpah05034   Alcoholism mpah05202   Transcriptional misregulation in cancer mpah05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mpah00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     110333938  09160 Human Diseases   09161 Cancer: overview    05202 Transcriptional misregulation in cancer     110333938   09163 Immune disease    05322 Systemic lupus erythematosus     110333938   09165 Substance dependence    05034 Alcoholism     110333938  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mpah03036]     110333938   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mpah04147]     110333938 Chromosome and associated proteins [BR:mpah03036]  Eukaryotic type   Nucleosome assembly factors    Histones     110333938 Exosome [BR:mpah04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110333938 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CENP-T_C CENP-S PAF CBFD_NFYB_HMF YebU_pre-PUA_dom TFIID-31kDa Motif Other DBs NCBI-GeneID:  110333938 NCBI-ProteinID:  XP_021071384 LinkDB All DBs Position 16:27524108..27524679 Genome browser AA seq 136 aa AA seqDB search MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTACFSEIRRYQKSTE LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI MPKDIQLARRIRGERA NT seq 411 nt NT seq  +upstreamnt  +downstreamnt atggcccgtactaagcagaccgctcgcaagtccaccggcggcaaggctccgcgcaagcag ctggccaccaaggccgcccgcaagagcgccccggccaccggcggcgtgaagaagccccac cgctaccgtcccggcaccgcctgcttcagcgagatccggcgctaccagaagtcgaccgag ctgctgatccgcaagctgccgttccagcggctagtgcgcgagatcgcgcaggacttcaag accgacctgcgcttccagagctcggccgtcatggctctgcaggaggcgagcgaggcctac cttgtgggtctgtttgaggacaccaacctgtgcgccatccacgccaagcgtgtcactatc atgcccaaggacatccagctggctcgccgcattcgtggggagagggcttaa

DBGET integrated database retrieval system