Mus pahari (shrew mouse): 110333988 Help Entry 110333988         CDS       T05929                                  Symbol Pfn3 Name (RefSeq) profilin-3   KO K05759   profilin Organism mpah  Mus pahari (shrew mouse) Pathway mpah04015   Rap1 signaling pathway mpah04810   Regulation of actin cytoskeleton mpah05014   Amyotrophic lateral sclerosis mpah05132   Salmonella infection Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04015 Rap1 signaling pathway     110333988 (Pfn3)  09140 Cellular Processes   09142 Cell motility    04810 Regulation of actin cytoskeleton     110333988 (Pfn3)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     110333988 (Pfn3)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     110333988 (Pfn3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mpah04131]     110333988 (Pfn3)   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:mpah04812]     110333988 (Pfn3)    04147 Exosome [BR:mpah04147]     110333988 (Pfn3) Membrane trafficking [BR:mpah04131]  Others   Actin-binding proteins    Others     110333988 (Pfn3) Cytoskeleton proteins [BR:mpah04812]  Eukaryotic cytoskeleton proteins   Actin filaments / Microfilaments    Actin-binding proteins     Profilin      110333988 (Pfn3) Exosome [BR:mpah04147]  Exosomal proteins   Proteins found in most exosomes    110333988 (Pfn3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Profilin Motif Other DBs NCBI-GeneID:  110333988 NCBI-ProteinID:  XP_021071462 Ensembl:  MGP_PahariEiJ_G0019626 LinkDB All DBs Position 16:complement(58146254..58147073) Genome browser AA seq 137 aa AA seqDB search MSDWKGYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRHTFL QTGLSVAGRRCCVIRDYLLAEGDGVLDARTKGLDGRAICVGHTPRALLVLMGRRGVHGGI LNKTVHDLIGGLREQCS NT seq 414 nt NT seq  +upstreamnt  +downstreamnt atgagtgactggaagggctacatcagtgcggtgctgcgggatcagcgtatcgatgacgtg gctatcgtaggccactcggacaatcgctgtgtgtgggcatcgcggcctgggggtctgctg gcggccatctccccgcaggaggtgggtgtgctcaccgggccggaccggcacacctttctg cagacgggtctgagcgtggcaggccgccgctgctgcgttatccgtgactacctgctggcc gagggtgacggcgtactggatgcgcgcaccaaggggctggacgggcgtgcaatctgtgtg ggccacacgccacgggcgctcctggtgctcatgggcagacgaggcgtgcatggaggcatc ctcaataagacagtgcacgatctgattggcgggctgcgtgagcagtgctcttag

DBGET integrated database retrieval system