Mus pahari (shrew mouse): 110334108 Help Entry 110334108         CDS       T05929                                  Name (RefSeq) histone H2B type 1-M   KO K11252   histone H2B Organism mpah  Mus pahari (shrew mouse) Pathway mpah04613   Neutrophil extracellular trap formation mpah05034   Alcoholism mpah05203   Viral carcinogenesis mpah05322   Systemic lupus erythematosus Brite KEGG Orthology (KO) [BR:mpah00001]  09150 Organismal Systems   09151 Immune system    04613 Neutrophil extracellular trap formation     110334108  09160 Human Diseases   09161 Cancer: overview    05203 Viral carcinogenesis     110334108   09163 Immune disease    05322 Systemic lupus erythematosus     110334108   09165 Substance dependence    05034 Alcoholism     110334108  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:mpah03036]     110334108   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mpah04147]     110334108 Chromosome and associated proteins [BR:mpah03036]  Eukaryotic type   Nucleosome assembly factors    Histones     110334108 Exosome [BR:mpah04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110334108 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF YscO-like TFIID_20kDa Motif Other DBs NCBI-GeneID:  110334108 NCBI-ProteinID:  XP_021071627 Ensembl:  MGP_PahariEiJ_G0019338 LinkDB All DBs Position 16:25036351..25036771 Genome browser AA seq 126 aa AA seqDB search MPEPTKSAPAPKKGSKKAVTKAQKKDGKKRKRSRKESYSVYVYKVLKQVHPDTGISSKAM GIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVT KYTSSK NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgcctgagccaacgaaatccgctcccgccccgaagaagggctccaagaaggccgtgacc aaggcccagaagaaggatggcaagaagcgcaagcgcagccgcaaggagagctactcggtg tacgtgtacaaggtgctgaagcaagtgcaccccgacacgggcatctcctccaaggccatg ggcatcatgaactcgttcgtgaacgacatcttcgagcgcatcgcgggcgaggcgtcccgc ctggcgcactacaacaagcgctccaccatcacgtcccgggagatccagacggccgtgcgc ctgctgctgcccggggagctggccaagcacgccgtgtcggagggcaccaaggctgtcacc aagtacaccagctccaagtga

DBGET integrated database retrieval system