Mus pahari (shrew mouse): 110334170 Help Entry 110334170         CDS       T05929                                  Symbol Calml3 Name (RefSeq) calmodulin-like protein 3   KO K02183   calmodulin Organism mpah  Mus pahari (shrew mouse) Pathway mpah04014   Ras signaling pathway mpah04015   Rap1 signaling pathway mpah04020   Calcium signaling pathway mpah04022   cGMP-PKG signaling pathway mpah04024   cAMP signaling pathway mpah04070   Phosphatidylinositol signaling system mpah04114   Oocyte meiosis mpah04218   Cellular senescence mpah04261   Adrenergic signaling in cardiomyocytes mpah04270   Vascular smooth muscle contraction mpah04371   Apelin signaling pathway mpah04625   C-type lectin receptor signaling pathway mpah04713   Circadian entrainment mpah04720   Long-term potentiation mpah04722   Neurotrophin signaling pathway mpah04728   Dopaminergic synapse mpah04740   Olfactory transduction mpah04744   Phototransduction mpah04750   Inflammatory mediator regulation of TRP channels mpah04910   Insulin signaling pathway mpah04912   GnRH signaling pathway mpah04915   Estrogen signaling pathway mpah04916   Melanogenesis mpah04921   Oxytocin signaling pathway mpah04922   Glucagon signaling pathway mpah04924   Renin secretion mpah04925   Aldosterone synthesis and secretion mpah04970   Salivary secretion mpah04971   Gastric acid secretion mpah05010   Alzheimer disease mpah05012   Parkinson disease mpah05022   Pathways of neurodegeneration - multiple diseases mpah05031   Amphetamine addiction mpah05034   Alcoholism mpah05133   Pertussis mpah05152   Tuberculosis mpah05163   Human cytomegalovirus infection mpah05167   Kaposi sarcoma-associated herpesvirus infection mpah05170   Human immunodeficiency virus 1 infection mpah05200   Pathways in cancer mpah05214   Glioma mpah05417   Lipid and atherosclerosis mpah05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     110334170 (Calml3)    04015 Rap1 signaling pathway     110334170 (Calml3)    04070 Phosphatidylinositol signaling system     110334170 (Calml3)    04024 cAMP signaling pathway     110334170 (Calml3)    04022 cGMP-PKG signaling pathway     110334170 (Calml3)  09150 Organismal Systems   09152 Endocrine system    04922 Glucagon signaling pathway     110334170 (Calml3)    04915 Estrogen signaling pathway     110334170 (Calml3)    04921 Oxytocin signaling pathway     110334170 (Calml3)    04924 Renin secretion     110334170 (Calml3)    04925 Aldosterone synthesis and secretion     110334170 (Calml3)   09154 Digestive system    04970 Salivary secretion     110334170 (Calml3)    04971 Gastric acid secretion     110334170 (Calml3)   09156 Nervous system    04728 Dopaminergic synapse     110334170 (Calml3)    04720 Long-term potentiation     110334170 (Calml3)    04722 Neurotrophin signaling pathway     110334170 (Calml3)   09157 Sensory system    04740 Olfactory transduction     110334170 (Calml3)    04750 Inflammatory mediator regulation of TRP channels     110334170 (Calml3)   09159 Environmental adaptation    04713 Circadian entrainment     110334170 (Calml3)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110334170 (Calml3)   09162 Cancer: specific types    05214 Glioma     110334170 (Calml3)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     110334170 (Calml3)    05163 Human cytomegalovirus infection     110334170 (Calml3)    05167 Kaposi sarcoma-associated herpesvirus infection     110334170 (Calml3)   09171 Infectious disease: bacterial    05133 Pertussis     110334170 (Calml3)    05152 Tuberculosis     110334170 (Calml3)   09164 Neurodegenerative disease    05010 Alzheimer disease     110334170 (Calml3)    05012 Parkinson disease     110334170 (Calml3)    05022 Pathways of neurodegeneration - multiple diseases     110334170 (Calml3)   09165 Substance dependence    05031 Amphetamine addiction     110334170 (Calml3)    05034 Alcoholism     110334170 (Calml3)   09166 Cardiovascular disease    05417 Lipid and atherosclerosis     110334170 (Calml3)    05418 Fluid shear stress and atherosclerosis     110334170 (Calml3)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:mpah01009]     110334170 (Calml3)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mpah04131]     110334170 (Calml3)    03036 Chromosome and associated proteins [BR:mpah03036]     110334170 (Calml3)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mpah04147]     110334170 (Calml3) Protein phosphatases and associated proteins [BR:mpah01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      110334170 (Calml3) Membrane trafficking [BR:mpah04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     110334170 (Calml3) Chromosome and associated proteins [BR:mpah03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      110334170 (Calml3) Exosome [BR:mpah04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    110334170 (Calml3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_1 EF-hand_7 EF-hand_6 EF-hand_8 EF-hand_5 EF-hand_9 AIF-1 EH SPARC_Ca_bdg EF_EFCAB10_C UPF0154 EFhand_Ca_insen Dockerin_1 EF-hand_11 DUF5580_M RNA_pol_Rpb4 FCaBP_EF-hand Caleosin dCache_2 DUF1103 SPEF2_C SurA_N_2 SurA_N_3 DUF6279 RFC1 Motif Other DBs NCBI-GeneID:  110334170 NCBI-ProteinID:  XP_021071696 Ensembl:  MGP_PahariEiJ_G0019242 LinkDB All DBs Position 16:complement(9172287..9173717) Genome browser AA seq 149 aa AA seqDB search MADQLTEEQIAEFKEAFSLFDKDGDGSITTQELGTVMRSLGQNPTEAELQGMVNEIDKDG NGTVDFPEFLTMMSRKMKDTDSEEEIREAFRVFDKDGNGFVSAAELRHVMTKLGEKLSDE EVDEMIQAADTDGDGQVNYEEFVHMLVSK NT seq 450 nt NT seq  +upstreamnt  +downstreamnt atggccgaccagctgactgaggagcaaatcgccgagttcaaagaggctttctctctgttt gacaaggatggggatggcagtatcaccacccaagaactgggcactgtcatgcggtccctg ggtcagaaccccacagaggctgagctccaaggcatggtgaatgaaattgacaaggatggg aacggcaccgtggacttccccgagttcctgacaatgatgtccaggaagatgaaagacact gacagcgaggaagagatccgggaggccttccgagtgttcgacaaggatggcaacggcttc gtcagtgcagccgagctgaggcacgtgatgaccaagctgggggagaaactgagcgacgag gaggtggacgaaatgatacaggcggcagatacagatggtgatgggcaagtgaactatgag gagtttgtccacatgctggtgtccaaatga

DBGET integrated database retrieval system