KEGG   Mus pahari (shrew mouse): 110334620
Entry
110334620         CDS       T05929                                 
Symbol
Cntn1
Name
(RefSeq) contactin-1
  KO
K06759  contactin 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110334620 (Cntn1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mpah04515]
    110334620 (Cntn1)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
    110334620 (Cntn1)
Cell adhesion molecules [BR:mpah04515]
 Immunoglobulin superfamily
  Contactins
   110334620 (Cntn1)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
 Others
  110334620 (Cntn1)
SSDB
Motif
Pfam: Ig_3 I-set Ig_2 ig fn3 V-set Ig_5 Ig_4 Pur_ac_phosph_N C2-set_2 Big_3_4 Interfer-bind ChitinaseA_N
Other DBs
NCBI-GeneID: 110334620
NCBI-ProteinID: XP_021072043
Ensembl: MGP_PahariEiJ_G0020191
LinkDB
Position
17:56812419..57101318
AA seq 1020 aa
MKMPLLVSHLLLISLTSCLGDFTWHRRYGHGVSEEDKGFGPIFEEQPINTIYPEESLEGK
VSLNCRARASPFPVYKWRMNNGDVDLTNDRYSMVGGNLVINNPDKQKDAGVYYCLASNNY
GMVRSTEATLSFGYLDPFPPEERPEVKVKEGKGMVLLCDPPYHFPDDLSYRWLLNEFPVF
ITMDKRRFVSQTNGNLYIANVESSDRGNYSCFVSSPSITKSVFSKFIPLIPIPERTTKPY
PADIVVQFKDIYTMMGQNVTLECFALGNPVPDIRWRKVLEPMPSTAEISTSGAVLKIFNI
QLEDEGLYECEAENIRGKDKHQARIYVQAFPEWVEHINDTEVDIGSDLYWPCVATGKPIP
TIRWLKNGYAYHKGELRLYDVTFDNAGMYQCIAENAYGSIYANAELKILALAPTFEMNPM
KKKILAAKGGRVIIECKPKAAPKPKFSWSKGTEWLVNSSRILIWEDGSLEINNITRNDGG
IYTCFAENNRGKANSTGTLVITNPTRIILAPINADITVGENATMQCAASFDPALDLTFVW
SFNGYVIDFNKEITHIHYQRNFMLDANGELLIRNAQLKHAGRYTCTAQTIVDNSSASADL
VVRGPPGPPGGLRIEDIRATSVALTWSRGSDNHSPISKYTIQTKTILSDDWKDAKTDPPI
IEGNMESAKAVDLIPWMEYEFRVVATNTLGTGEPSIPSNRIKTDGAAPNVAPSDVGGGGG
TNRELTITWAPLSREYHYGNNFGYIVAFKPFDGEEWKKVTVTNPDTGRYVHKDETMTPST
AFQVKVKAFNNKGDGPYSLVAVINSAQDAPSEAPTEVGVKVLSSSEISVHWKHVLEKIVE
SYQIRYWAGHDKETAAHRVQVTSQEYSVRLENLLPDTQYFIEVGACNSAGCGPSSDVIET
FTRKAPPSQPPRIISSVRSGSRYIITWDHVVALSNESTVTGYKILYRPDGQHDGKLFSTH
KHSIEVPIPRDGEYVVEVRAHSDGGDGVVSQVKISGVSTLSSGLLSLLLPSLGFLVYSEF
NT seq 3063 nt   +upstreamnt  +downstreamnt
atgaaaatgccattgctggtcagccatctcctgctaatctccttaacatcctgtctagga
gactttacatggcacagaagatatggtcatggagtgtccgaggaggacaaaggatttggg
cccatctttgaagagcaaccaatcaataccatttacccagaagagtcactggaaggaaaa
gtatcactcaactgccgggcacgcgccagcccatttccagtttacaaatggagaatgaat
aatggggacgtggacttgacaaacgaccggtacagtatggtgggaggaaaccttgttatc
aacaaccccgacaaacagaaggacgctggggtatactactgcctggcatccaacaactat
ggaatggtcaggagcacagaggcaaccctgagcttcgggtatctcgacccctttcctccc
gaggagcgtccggaagtgaaggtgaaggaagggaaaggcatggtgcttctctgcgatcct
ccctaccacttcccagatgatcttagctaccgctggcttctgaatgaatttcctgtattt
atcaccatggataaacgaagatttgtgtctcagaccaacggcaatctctacatcgcaaat
gtcgagtcctctgacagaggcaactactcctgctttgtgtccagtccttccattacaaag
agtgtgttcagcaagtttatacccctcattccaatacctgaacgaacaacaaagccatat
cctgctgatattgtggtgcagttcaaggacatatacaccatgatgggccaaaatgtgact
ttagagtgtttcgctcttgggaaccctgttcctgatatccggtggcggaaggtgctagaa
ccaatgcctagcactgccgagataagcacctcaggggctgtcctcaagatcttcaacatc
cagctagaagatgaaggcctctacgagtgtgaggctgagaacatccggggaaaggacaag
caccaggcaagaatttatgttcaagcatttcctgaatgggtagagcatatcaatgacact
gaggtggacataggcagcgacctctactggccttgcgtggccacagggaagcccattcct
accatcaggtggctgaaaaatggatacgcgtatcataaaggagaactgagactgtatgat
gtgacttttgacaatgctgggatgtaccagtgcatagcagaaaatgcgtatgggtccatt
tatgcaaacgcggagctcaagatcctggctttagctccaacttttgaaatgaatcctatg
aagaaaaagatcttggctgcgaaaggaggaagggttatcattgagtgtaaacccaaggct
gcaccaaaacccaagttttcatggagcaaagggacagagtggctcgtcaacagcagcaga
atactcatatgggaagatggtagcttggaaatcaataatattacaagaaatgatggcgga
atctacacgtgctttgcagaaaataacagagggaaagctaatagtactgggactctggtg
atcacaaatcccacacgaatcattttggccccaatcaatgctgacatcactgttggggaa
aatgccaccatgcagtgtgctgcatctttcgatcctgccttggacctcacgtttgtgtgg
tccttcaatggctacgtgattgactttaacaaagaaattactcatattcattaccagagg
aattttatgctcgacgccaatggggaactgctcatccgaaatgcgcagctgaaacacgca
ggcaggtacacgtgcacggcccagacaatcgtggacaattcctcggcttcagctgacctt
gtcgtacgaggccccccaggccctccaggaggcctgagaatagaagacatcagagctacc
tctgtggcactgacttggagccgtggttcagacaatcacagccctatctctaaatacact
atccagaccaagacgattctctcagacgactggaaagatgcaaagacagatcccccaatc
attgaaggaaatatggagtcagccaaagcagtggatttgatcccatggatggagtatgaa
tttcgagtggtggcgaccaatactttagggaccggagagcccagcataccctcaaacagg
atcaaaacagacggtgctgcaccaaatgtggctccctcagatgtaggtggtgggggcgga
accaacagagagctgacaataacgtgggcgcctttgtcgagagagtaccattacggtaac
aattttggttacatagtggcatttaagccatttgatggagaagagtggaagaaagttact
gtgactaacccagacactggccgctatgtccacaaagatgagaccatgaccccttctacc
gcgtttcaagtcaaagtgaaagcattcaacaataaaggagatgggccctacagccttgta
gctgtcatcaactctgcacaagacgctcccagtgaagcccccacagaggtaggggtcaaa
gtgttatcatcctctgagatatctgtgcattggaagcatgtgttagagaaaattgtggaa
agctatcagattcggtactgggctgggcatgacaaagaaacagcagcacacagagttcag
gtcaccagccaggagtactcagtcaggctggagaaccttctgcctgacacccagtacttc
attgaagtgggagcctgcaacagtgccgggtgcggaccttctagtgacgtgatcgagacc
ttcaccagaaaagcccctcccagccaaccaccaaggatcatcagttctgtgaggtctggc
tcccggtatataatcacatgggatcacgttgtggcactatccaatgaatctactgtgaca
ggctacaagatactctatagaccggatggccagcatgacggcaagctgttctcaacccat
aaacactccatagaagtccccatccccagagacggagagtatgttgtcgaggttcgagca
cacagtgacgggggagacggagtcgtgtctcaagtcaaaatttcaggtgtgtccacgctg
tcttcgggtctcctcagcttgctcctgccctcccttggctttcttgtctactcggaattc
tga

DBGET integrated database retrieval system