Mus pahari (shrew mouse): 110335587 Help Entry 110335587         CDS       T05929                                  Name (RefSeq) glutathione S-transferase P 2   KO K23790   glutathione S-transferase P [EC:2.5.1.18] Organism mpah  Mus pahari (shrew mouse) Pathway mpah00480   Glutathione metabolism mpah00980   Metabolism of xenobiotics by cytochrome P450 mpah00982   Drug metabolism - cytochrome P450 mpah00983   Drug metabolism - other enzymes mpah01100   Metabolic pathways mpah01524   Platinum drug resistance mpah05200   Pathways in cancer mpah05204   Chemical carcinogenesis - DNA adducts mpah05215   Prostate cancer mpah05225   Hepatocellular carcinoma mpah05418   Fluid shear stress and atherosclerosis Brite KEGG Orthology (KO) [BR:mpah00001]  09100 Metabolism   09106 Metabolism of other amino acids    00480 Glutathione metabolism     110335587   09111 Xenobiotics biodegradation and metabolism    00980 Metabolism of xenobiotics by cytochrome P450     110335587    00982 Drug metabolism - cytochrome P450     110335587    00983 Drug metabolism - other enzymes     110335587  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110335587    05204 Chemical carcinogenesis - DNA adducts     110335587   09162 Cancer: specific types    05225 Hepatocellular carcinoma     110335587    05215 Prostate cancer     110335587   09166 Cardiovascular disease    05418 Fluid shear stress and atherosclerosis     110335587   09176 Drug resistance: antineoplastic    01524 Platinum drug resistance     110335587  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02000 Transporters [BR:mpah02000]     110335587 Enzymes [BR:mpah01000]  2. Transferases   2.5  Transferring alkyl or aryl groups, other than methyl groups    2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)     2.5.1.18  glutathione transferase      110335587 Transporters [BR:mpah02000]  Other transporters   Pores ion channels [TC:1]    110335587 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GST_C_3 GST_C GST_N GST_C_7 Motif Other DBs NCBI-GeneID:  110335587 NCBI-ProteinID:  XP_021073469 LinkDB All DBs Position 1:50988446..50989078 Genome browser AA seq 210 aa AA seqDB search MPPYTIVYFPSQGRCEAMHMLLADQGQSWKEEVVTIDTWIQGLLKPTCLYGQLPKFEDRD LTLYQSNAILRHLGCSLGLYGKDQREAAQVDMVNFGVEDLRCKYGTMIYRNYENDKDDYV KALPGHLKPFETPLPQNQGGKAFVVGDQISFADYNLLDLLLIHRVLAPDCLDNFPLLSAY VAHFSARPKIKAFLSSPEHVNHPINGNGKQ NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atgccaccgtataccattgtctacttcccaagtcaagggcggtgtgaggccatgcacatg ttgctggctgaccagggccagagctggaaggaggaagtggttaccatagatacctggata caaggcttgctcaagcctacttgtctgtatgggcagctccccaaatttgaggatagagac ctcaccctttaccaatctaatgccatcttgaggcaccttggctgctctttggggctttat gggaaggaccagagggaggccgcccaggtggatatggtgaattttggggtggaggacctt cgctgcaaatatggtaccatgatctacagaaactatgagaacgataaggatgactatgtg aaggccctgcctgggcatctgaagccttttgagaccccgctaccccagaaccagggaggc aaagctttcgttgtcggtgaccagatctcctttgccgattacaacttgctggacctgctg ctgatccaccgagtcctggcccctgactgcctggacaacttccctctgctctctgcctat gtggctcacttcagtgccagacccaagatcaaggcctttctgtcctccccggaacatgtg aaccatcccatcaatggcaatggcaaacagtag

DBGET integrated database retrieval system