KEGG   Mus pahari (shrew mouse): 110335652
Entry
110335652         CDS       T05929                                 
Symbol
C3
Name
(RefSeq) complement C3
  KO
K03990  complement component 3
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04080  Neuroactive ligand-receptor interaction
mpah04145  Phagosome
mpah04610  Complement and coagulation cascades
mpah04613  Neutrophil extracellular trap formation
mpah04936  Alcoholic liver disease
mpah05133  Pertussis
mpah05134  Legionellosis
mpah05140  Leishmaniasis
mpah05142  Chagas disease
mpah05150  Staphylococcus aureus infection
mpah05152  Tuberculosis
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05171  Coronavirus disease - COVID-19
mpah05203  Viral carcinogenesis
mpah05322  Systemic lupus erythematosus
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110335652 (C3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    110335652 (C3)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110335652 (C3)
   04613 Neutrophil extracellular trap formation
    110335652 (C3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    110335652 (C3)
  09172 Infectious disease: viral
   05171 Coronavirus disease - COVID-19
    110335652 (C3)
   05168 Herpes simplex virus 1 infection
    110335652 (C3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110335652 (C3)
  09171 Infectious disease: bacterial
   05133 Pertussis
    110335652 (C3)
   05134 Legionellosis
    110335652 (C3)
   05150 Staphylococcus aureus infection
    110335652 (C3)
   05152 Tuberculosis
    110335652 (C3)
  09174 Infectious disease: parasitic
   05140 Leishmaniasis
    110335652 (C3)
   05142 Chagas disease
    110335652 (C3)
  09163 Immune disease
   05322 Systemic lupus erythematosus
    110335652 (C3)
  09167 Endocrine and metabolic disease
   04936 Alcoholic liver disease
    110335652 (C3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110335652 (C3)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:mpah04131]
    110335652 (C3)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110335652 (C3)
Peptidases and inhibitors [BR:mpah01002]
 Peptidase inhibitors
  Family I39: alpha2M family
   110335652 (C3)
Membrane trafficking [BR:mpah04131]
 Endocytosis
  Phagocytosis
   Opsonins
    110335652 (C3)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of other cancer cells
   110335652 (C3)
SSDB
Motif
Pfam: TED_complement A2M A2M_BRD A2M_recep MG4 NTR MG1 MG2 MG3 ANATO CarboxypepD_reg
Other DBs
NCBI-GeneID: 110335652
NCBI-ProteinID: XP_021073591
Ensembl: MGP_PahariEiJ_G0020799
LinkDB
Position
18:complement(24329574..24355773)
AA seq 1663 aa
MGPASGPQLLMLLLLLASSPLALGAPMYSIITPNVLRLESEETIVLEAHDAQGDIPVTVT
VQDFLKKQVLTSEKTVLTGASGHLARVSIKIPASKEFNSDKEGHKYVTVVANFRETVVEK
AVMVSFQSGYLFIQTDKTIYTPGSTVLYRIFTVDNNLLPVGKTVVILIETPDGVPVKRDI
LSSHNQNGILPMSWNIPELVNMGQWKIRAFYEHAPKQTFSAEFEVKEYVLPSFEVVVEPT
EKYYYIDDPDGLEVSITAKFLYGKNVDGTAFVIFGVQDGDQKISLAQSLKRVVIEDGVGD
AVLPRQVLMDGVQPSNGNALVGKSLYVSVTVILHSGSDMVEAERSGIPIVTSPYQIHFTK
TPKFFKPAMPFDLMVFVTNPDGSPASKVQVVAEGSNAKALTQEDGVAKLTINTPNSRQPL
RITVRTNKETLPDARQATMTMHAQPYSTMHNSNNYLHLSVSRMELKPGDNLNVNFHLRTD
PGQEAKIRHYTYLVMNKGRLLKAGRQVREPGQDLVVLSLPITPEFIPSFRLVAYYTMIGT
SGQREVVADSVWVDVKDSCVGTLVVKGNQRENHFTPGQQTTLRIEGNHGARVGLVAVDKG
VFVLNKKNKLTQSKIWDVVEKADIGCTPGSGKNYAGVFMDAGLAFKTNQGLQTEQRADLE
CAKPAARRRRSVQLMERRMDKAGQYTDKGLRKCCEDGMRDIPMRYSCQRRARLITQGENC
IKAFIDCCNHITKLREQHKRNHVLGLARSDLEEEIIPEEDIVSRTHFPESWLWTIEELKE
PAKNGISTKVMNIFLKDSITTWEIMAVSLSDKKGICVADPYEIRVMQDFFIDLRLPYSVV
RNEQVEIRAVLFNYREQEELTVRVELLQNPAFCSMATAKKRYFQTIKIPPKSSVAVPYVI
VPLKLGLQEVEVKAAVFNHFISDGVKKMLKVVPEGMRVNKTVAVHTLDPEKLGQGGVQKV
DVPAADLSDQVPDTDSETRILLQGSPVVQMAEDAVDGERLKHLIVTPSGCGEQNMIGMTP
TVIAVHYLDQTEQWEKFGVEKRQESLELIKKGYTQQLAFKQPNSAYAAFNNRPPSTWLTA
YVVKVFALAANLIAIDSQVLCGAVKWLILEKQKPDGVFQEDGPVIHQEMIGGFRDSKEAD
VSLTAFVLIALQEARDICEGQVNSLPGSINKAGEYIEASYMNLQRPYTVAIAGYALALLN
KLEEPYLSKFRNTAKDGNRWEEPDQKLYNVEATSYALLALLLLKDFDSVPPVVRWLNEQR
YYGGGYGSTQATFMVFQALAQYQTDVPDHKELNMDVSFHLPSRSSETKFRLLWENGNLLR
SEETKQNEAFSLTAKGKGQGTLSVVTVYHAKVKGKAPCNKFDLRVSIRPAPETVKKPEEA
KNTMFLEICTRYLGEVDATMSILDISMMTGFAPDKNDLETLTAGVDRYISKYEMNKAFSN
KNTLIIYLEKISHTEEDCLTFKVHQYFNVGLIQPGSVKVYSYYNLEESCTRFYHPEKDDG
MLSKLCHNEMCRCAEENCFMQQSQEKINLNVRLDKACEPGVDYVYKTKLSKIELWNDFDE
YTMTIEQVIKSGSDEVQVEQERKFISHIKCRNALKLQEGKKYLMWGLSSDLWGEKPNTSY
IIGKDTWVEHWPEAEECQDQKYQKQCEDLGAFTETMVVFGCPN
NT seq 4992 nt   +upstreamnt  +downstreamnt
atgggaccagcttcagggccccagctactaatgctactgttgctcttggccagctccccg
ctagctctgggggcccctatgtattccatcattactcccaatgtcctacggctggagagc
gaagagaccattgtactggaggcccacgatgctcagggtgacatcccagtcacggtcact
gtgcaagacttcctaaagaagcaagtgctgaccagcgagaagacagtgttgacaggagcc
agtggacatctggcaagagtctccatcaagattccagccagtaaggaattcaactcagat
aaggaggggcacaagtacgtgacagtggtggcaaacttcagggaaacagtggtggagaaa
gcagtgatggtaagcttccagagtgggtacctcttcatccagacagacaagaccatctac
accccgggctccaccgtcttatatcggatcttcactgtggacaacaacctactgcccgtg
ggcaagacagtcgtcatcctcattgagacccccgacggcgttcctgtcaagagagacatt
ctgtcttcccacaaccaaaacggcatcttgcctatgtcttggaacattccagaactggtc
aacatggggcagtggaagatccgagccttctacgaacatgcgccgaagcagaccttctcg
gccgagtttgaggtgaaggaatacgtgctgcccagtttcgaggtcgtggtggagcccaca
gagaaatattattacatcgatgacccagacggcctggaagtttccatcacagccaagttc
ctgtacgggaagaacgtggacgggacagccttcgtgattttcggggtccaggatggcgat
cagaagatttctctggcccaatccctcaagcgcgtagtgatcgaggatggtgtgggggat
gcagtgctgccccggcaggtgctgatggacggggtacagccttccaacggcaacgccctg
gtggggaagtccctgtatgtctccgtcactgtcatcctgcactcaggtagtgatatggta
gaggcagagcgcagtgggatcccaattgtcacttccccgtaccaaatccacttcaccaag
acacccaaattcttcaagccggccatgccctttgacctcatggtgttcgtgaccaaccct
gatggctctccggccagcaaagtgcaggtggtcgctgagggatccaatgcaaaggctctc
acccaagaagatggtgtggccaagctgaccatcaacacacccaacagccgccaacccctg
aggatcacggtccggaccaataaggaaactctcccagatgcacggcaggccaccatgaca
atgcatgcccagccttacagcactatgcacaactccaacaactacctccacttgtcagtg
tctcgcatggagctcaagccgggggacaacctcaatgtcaacttccacctgcgcacagac
ccaggccaagaggccaagatccgacactacacctacctggttatgaacaaggggaggctc
ctgaaggcaggccgccaggttcgggagcctggccaggacctggtggtcttgtccctgccc
atcactccagagttcattccttcctttcgcctggtggcttactacaccatgattggaact
agtggccaaagagaggtggtggctgactctgtgtgggtggatgtgaaggattcctgtgta
ggcacgctggtggtgaagggtaaccaaagagagaaccatttcacacctgggcaacaaacg
acactcaggattgagggaaaccatggggcccgagtggggctagtggctgtggacaaggga
gtgtttgtgctgaacaagaagaacaaactcacacagagcaagatctgggatgtggtagag
aaggcagacattggctgcacccctggcagtgggaagaactatgctggtgtcttcatggat
gcaggcctggccttcaagacaaaccaaggactgcagactgagcagagagcagatcttgag
tgcgccaagccagcagcccgccgccgtcgctcagtacagttgatggaaagaaggatggac
aaagctggtcagtacaccgacaagggtctgcggaagtgttgcgaggacggtatgcgggat
atccctatgagatacagctgccagcgccgcgcacgcctcatcacccagggcgagaactgc
ataaaggccttcatagactgctgcaaccacatcaccaagctgcgtgaacaacacaaaaga
aaccatgtgctgggcctggccaggagtgacttggaggaagaaataattccagaagaagat
attgtctctagaacccacttcccagagagctggttgtggaccatagaagagttgaaagaa
ccagcgaaaaatggaatctctacgaaggtcatgaacatcttcctcaaagattccatcacc
acctgggagattatggcagtgagcttgtcagacaagaaagggatctgtgtggcagacccc
tatgagatcagagtgatgcaggacttcttcattgacctgcggctgccctactctgtagtg
cgcaatgaacaggtggagatcagagctgtgctcttcaactaccgtgaacaggaggaactt
acggtgagggtggaactgttgcaaaatccagccttctgcagcatggccaccgccaagaag
cgctacttccagaccatcaaaatccctcccaagtcctccgtggctgtaccttatgtcatt
gtccccctgaagctcggcctccaagaggtggaggtcaaggctgctgtcttcaatcacttc
atcagtgatggtgtcaagaagatgctgaaggtcgtgccagaaggaatgagagtcaacaaa
actgtggccgtccatacactggacccagagaaactcggccaagggggagtgcagaaggtg
gatgtgcctgcggcagacctcagtgaccaagtgccggacacagactctgagaccagaatt
ctcctgcaagggagcccggtggttcagatggccgaagatgctgtggacggggagcggctg
aaacacctgatcgtgaccccctcaggctgtggggagcagaacatgatcggcatgacacca
acagtcattgcggtacactacctggaccagaccgaacagtgggagaagttcggtgtagag
aagaggcaagagtccctggagctcatcaagaaagggtacacccagcagctggccttcaaa
caacccaactctgcctatgctgccttcaacaaccggccccctagcacctggctgacagcc
tacgtggtcaaggtcttcgctctggctgccaacctcatcgccatcgactctcaggtcctg
tgtggggctgttaagtggctgattctggagaaacagaagccagatggtgtctttcaggag
gatgggcccgtgattcaccaagaaatgattggtggcttccgggacagcaaggaggcagac
gtgtcgctcacagccttcgtcctcatcgcactgcaggaagccagggatatctgtgagggg
caggtcaatagccttcctgggagcatcaacaaggcaggggagtatattgaagccagttac
atgaacctgcagagaccatacacagtggccattgctgggtatgccctggccctgttgaac
aaactggaggaaccttacctcagcaagtttcgtaacacagccaaagatgggaaccgctgg
gaggagcctgaccagaagctctacaacgtggaggccacatcctatgccctcctggccctg
ctgctgctgaaagactttgactctgtgcctcctgtggtgcgctggctcaatgagcaaaga
tactatggaggcggctatggctccacccaggccaccttcatggtattccaagccttggcc
caatatcaaacagatgtccccgaccataaggaattgaacatggatgtgtccttccacctc
cccagccgtagctccgaaaccaagtttcgcctgctctgggaaaatggcaacctcctgaga
tcggaagagaccaaacaaaatgaggccttctctctaacagccaaaggaaaaggccaaggc
acgttgtcggtggtgaccgtgtatcatgccaaagtcaaaggcaaagccccctgcaataag
tttgacctcagggtgagcataagaccagcccctgagacagtcaagaagcctgaggaagcc
aagaataccatgttcctggagatctgcaccaggtacttgggagaggtggatgccactatg
tccatcctggacatctccatgatgactggctttgctccagacaagaatgacctggaaacg
ctgaccgctggagtagacaggtacatctccaagtatgagatgaacaaagccttctccaac
aagaacaccctcatcatctacctagaaaagatctcacacaccgaagaagactgcctgacc
ttcaaagttcaccagtactttaatgtgggacttattcagcccgggtccgtcaaggtctac
tcctattacaacctcgaggaatcgtgcacccggttctatcatccggagaaggacgacggc
atgctcagcaagctgtgccacaacgaaatgtgccgatgtgctgaagagaactgcttcatg
caacagtcacaggagaagatcaacctgaacgtccggctagataaggcttgtgagcccgga
gtcgactacgtgtacaagaccaagctatccaagatagagctgtggaatgattttgatgag
tacaccatgaccatcgagcaggtcatcaagtcaggctcagatgaggtgcaggtagagcag
gaacgcaagttcatcagccacatcaagtgcagaaacgccctgaagctgcaggaagggaag
aaatacctcatgtggggcctctcctctgacctctggggagaaaagcccaacaccagctac
atcattgggaaggacacatgggtggagcactggcctgaggcagaggaatgccaggatcag
aagtaccagaaacagtgtgaagaccttggggcattcacagaaactatggtggtttttggt
tgccccaactga

DBGET integrated database retrieval system