Mus pahari (shrew mouse): 110336058 Help Entry 110336058         CDS       T05929                                  Symbol Rab5a Name (RefSeq) ras-related protein Rab-5A   KO K07887   Ras-related protein Rab-5A Organism mpah  Mus pahari (shrew mouse) Pathway mpah04014   Ras signaling pathway mpah04137   Mitophagy - animal mpah04144   Endocytosis mpah04145   Phagosome mpah04148   Efferocytosis mpah04962   Vasopressin-regulated water reabsorption mpah05014   Amyotrophic lateral sclerosis mpah05022   Pathways of neurodegeneration - multiple diseases mpah05132   Salmonella infection mpah05146   Amoebiasis mpah05152   Tuberculosis Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04014 Ras signaling pathway     110336058 (Rab5a)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     110336058 (Rab5a)    04145 Phagosome     110336058 (Rab5a)    04137 Mitophagy - animal     110336058 (Rab5a)    04148 Efferocytosis     110336058 (Rab5a)  09150 Organismal Systems   09155 Excretory system    04962 Vasopressin-regulated water reabsorption     110336058 (Rab5a)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     110336058 (Rab5a)    05152 Tuberculosis     110336058 (Rab5a)   09174 Infectious disease: parasitic    05146 Amoebiasis     110336058 (Rab5a)   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     110336058 (Rab5a)    05022 Pathways of neurodegeneration - multiple diseases     110336058 (Rab5a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mpah04131]     110336058 (Rab5a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mpah04147]     110336058 (Rab5a)    04031 GTP-binding proteins [BR:mpah04031]     110336058 (Rab5a) Membrane trafficking [BR:mpah04131]  Endocytosis   Rab GTPases and associated proteins    Rab GTPases     110336058 (Rab5a)  Endosome - Lysosome transport     110336058 (Rab5a) Exosome [BR:mpah04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110336058 (Rab5a)   Exosomal proteins of other body fluids (saliva and urine)    110336058 (Rab5a)   Exosomal proteins of colorectal cancer cells    110336058 (Rab5a)   Exosomal proteins of bladder cancer cells    110336058 (Rab5a) GTP-binding proteins [BR:mpah04031]  Small (monomeric) G-proteins   Rab Family    Rab5/17/22/31 [OT]     110336058 (Rab5a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA MMR_HSR1 GTP_EFTU RsgA_GTPase BrnT_toxin AAA_16 MCR_beta Motif Other DBs NCBI-GeneID:  110336058 NCBI-ProteinID:  XP_021074132 Ensembl:  MGP_PahariEiJ_G0020730 LinkDB All DBs Position 18:20889683..20909278 Genome browser AA seq 187 aa AA seqDB search MANRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQ TVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQR QASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIGKN MNVPHPS NT seq 564 nt NT seq  +upstreamnt  +downstreamnt atggctaatcgaggagcaacaagaccaaacgggccaaatactggaaataaaatatgccag ttcaaactggtccttctaggagaatctgctgttggcaaatcaagcctggttcttcgcttt gtgaaaggccaatttcatgaatttcaagagagtaccattggggctgcctttctaacccaa acagtgtgtcttgatgacacaacagtaaaatttgaaatatgggatacagctggccaagaa cggtatcacagcctagcaccaatgtactaccgaggagcacaagcagccatagttgtgtat gatatcacaaatgaggaatcctttgcgagagcaaaaaactgggttaaagaacttcagagg caagcaagtcctaatattgtgatagctttgtcaggaaacaaagctgacttagcaaataaa agagccgttgacttccaggaagcacagtcctatgcagatgacaacagcttattatttatg gagacatcagctaagacatcaatgaatgtaaatgaaatatttatggcaataggtaagaat atgaatgttcctcacccttcttaa

DBGET integrated database retrieval system