KEGG   Mus pahari (shrew mouse): 110336411
Entry
110336411         CDS       T05929                                 
Symbol
Plat
Name
(RefSeq) tissue-type plasminogen activator
  KO
K01343  tissue plasminogen activator [EC:3.4.21.68]
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04371  Apelin signaling pathway
mpah04610  Complement and coagulation cascades
mpah05202  Transcriptional misregulation in cancer
mpah05215  Prostate cancer
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    110336411 (Plat)
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110336411 (Plat)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    110336411 (Plat)
  09162 Cancer: specific types
   05215 Prostate cancer
    110336411 (Plat)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110336411 (Plat)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:mpah01002]
    110336411 (Plat)
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:mpah00536]
    110336411 (Plat)
Enzymes [BR:mpah01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.68  t-plasminogen activator
     110336411 (Plat)
Peptidases and inhibitors [BR:mpah01002]
 Serine peptidases
  Family S1: chymotrypsin family
   110336411 (Plat)
Glycosaminoglycan binding proteins [BR:mpah00536]
 Heparan sulfate / Heparin
  Coagulation and fibrinolysis
   110336411 (Plat)
SSDB
Motif
Pfam: Trypsin Kringle fn1 EGF DUF1986 Trypsin_2 hEGF EGF_2
Other DBs
NCBI-GeneID: 110336411
NCBI-ProteinID: XP_021074608
Ensembl: MGP_PahariEiJ_G0021371
LinkDB
Position
19:40722477..40747837
AA seq 563 aa
MGSKMKRELMCVLLLCGVAFALPDQGVHRRFRRGARSYRATCRDEPTQTTYQQHQSWLRP
MLRSSRVEYCRCNSGLVQCHSVPVRSCSEPRCFNGGTCQQALYFSDFVCQCPDGFVGKRC
DIDTRATCFKDQGITYRGTWSTAESGAECVNWNSSVLSLKPYNARRPNAIKLGLGNHNYC
RNPDRDLKPWCYVFKAGKYTTEFCSTPACPKGKSEDCYVGKGVTYRGTHSLTTSKASCLP
WNSIVLMGKSYTAWRTNSQALGLGRHNYCRNPDGDARPWCHVMKDRKLTWEYCDMSPCST
CGLRQYKRPQFRIKGGLYTDITSHPWQAAIFAKNKRSPGERFLCGGVLISPCWVLSAAHC
FLERFPPHHLKVVLGRTYRVVPGEEEQTFEIEKYIVHEKFDDDTYDNDIALLQLRSQSKQ
CAQESSSVGTACLPDPNLQLPDWTECELSGYGKHEASSPFFSDRLKEAHVRLYPSSRCTS
QHLFNKTITNNMLCAGDTRSGGNQDLHDACQGDSGGPLVCMINKQMTLTGIISWGLGCGQ
KDVPGVYTKVTNYLDWIHNNMKQ
NT seq 1692 nt   +upstreamnt  +downstreamnt
atggggagcaaaatgaagagagagctgatgtgtgtgctgctgctttgtggagtggctttc
gcattgcctgaccagggagtacacaggaggttcagaagaggagcccggtcctacagagca
acctgcagagacgagccaacgcagacaacttaccaacagcatcagtcgtggctccgaccc
atgctcagaagcagccgggtggaatattgccggtgcaacagcggcctggtacagtgccac
tcagtgcccgtccgaagttgcagtgaaccaagatgcttcaatggggggacctgtcagcag
gccctgtatttctctgactttgtctgccagtgccctgatggatttgtggggaaacgctgt
gacatagataccagagcaacatgctttaaggaccagggcatcacctacagaggcacgtgg
agcacagcagaaagtggggctgagtgtgtcaactggaatagcagtgttctgtcgctgaag
ccctacaatgcaaggaggccaaatgccatcaagctgggccttgggaatcacaactactgc
agaaacccagaccgagacttgaagccctggtgctatgtctttaaggcagggaagtatacc
acggagttctgcagcacgccagcttgccctaagggaaaaagcgaggactgctatgttggg
aaaggtgtgacttaccgtggcacccacagccttaccacatccaaggcctcctgcctcccc
tggaattccatagtcctcatgggcaagagttacacagcgtggaggaccaactcccaggca
ctcggcctgggcagacacaattattgccggaatccagatggagatgccagaccttggtgc
catgtgatgaaggaccgaaagctgacgtgggaatactgtgacatgtccccatgctccacc
tgtggcctgaggcagtacaaacggcctcagtttcgaattaaaggaggactctacacagac
atcacctcacacccttggcaggctgccatctttgccaagaacaagaggtctcccggagag
agattcctgtgtggaggggtgctaatcagcccctgctgggtgctgtcggctgctcactgc
tttctagagaggtttcccccccatcatcttaaagtggtcttgggcagaacatacagggtg
gtccccggagaggaagagcagacatttgagattgaaaaatacatagtccatgagaaattt
gatgacgacacttatgacaacgacatcgcattactgcagctgaggtcacagtccaagcaa
tgtgcccaggagagcagctctgtgggcactgcctgcctccctgaccccaacctacagctc
cctgactggacagagtgtgagctttctggctacggcaagcatgaggcatcgtctccgttc
ttctctgaccggctgaaggaggctcacgtccgactgtacccgtccagccgctgcacctca
cagcatctgtttaataaaaccatcacgaacaacatgctgtgcgctggagatacccggagc
ggaggcaaccaagacctccacgatgcttgccagggtgactcgggaggccctctggtgtgc
atgatcaataagcagatgacattgactggcatcatcagctggggccttggctgtgggcag
aaggatgtgcctggggtctacacaaaggttactaattacttagactggattcacaacaac
atgaagcaatga

DBGET integrated database retrieval system