Mus pahari (shrew mouse): 110336451 Help Entry 110336451         CDS       T05929                                  Symbol Rab8a Name (RefSeq) ras-related protein Rab-8A   KO K07901   Ras-related protein Rab-8A Organism mpah  Mus pahari (shrew mouse) Pathway mpah04140   Autophagy - animal mpah04144   Endocytosis mpah04152   AMPK signaling pathway mpah04530   Tight junction mpah04972   Pancreatic secretion mpah05014   Amyotrophic lateral sclerosis mpah05022   Pathways of neurodegeneration - multiple diseases Brite KEGG Orthology (KO) [BR:mpah00001]  09130 Environmental Information Processing   09132 Signal transduction    04152 AMPK signaling pathway     110336451 (Rab8a)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     110336451 (Rab8a)    04140 Autophagy - animal     110336451 (Rab8a)   09144 Cellular community - eukaryotes    04530 Tight junction     110336451 (Rab8a)  09150 Organismal Systems   09154 Digestive system    04972 Pancreatic secretion     110336451 (Rab8a)  09160 Human Diseases   09164 Neurodegenerative disease    05014 Amyotrophic lateral sclerosis     110336451 (Rab8a)    05022 Pathways of neurodegeneration - multiple diseases     110336451 (Rab8a)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:mpah04131]     110336451 (Rab8a)    03036 Chromosome and associated proteins [BR:mpah03036]     110336451 (Rab8a)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mpah04147]     110336451 (Rab8a)    04031 GTP-binding proteins [BR:mpah04031]     110336451 (Rab8a) Membrane trafficking [BR:mpah04131]  Exocytosis   Small GTPases and associated proteins    Rab GTPases     110336451 (Rab8a)  Autophagy   Other autophagy associated proteins     110336451 (Rab8a) Chromosome and associated proteins [BR:mpah03036]  Eukaryotic type   Centrosome formation proteins    Other centrosome associated proteins     110336451 (Rab8a) Exosome [BR:mpah04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    110336451 (Rab8a)   Exosomal proteins of other body fluids (saliva and urine)    110336451 (Rab8a)   Exosomal proteins of colorectal cancer cells    110336451 (Rab8a) GTP-binding proteins [BR:mpah04031]  Small (monomeric) G-proteins   Rab Family    Rab8/10/13 [OT]     110336451 (Rab8a) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA GTP_EFTU SRPRB MMR_HSR1 DUF3963 Septin AAA_7 Motif Other DBs NCBI-GeneID:  110336451 NCBI-ProteinID:  XP_021074676 Ensembl:  MGP_PahariEiJ_G0021676 LinkDB All DBs Position 19:86872470..86892082 Genome browser AA seq 207 aa AA seqDB search MAKTYDYLFKLLLIGDSGVGKTCVLFRFSEDAFNSTFISTIGIDFKIRTIELDGKRIKLQ IWDTAGQERFRTITTAYYRGAMGIMLVYDITNEKSFDNIRNWIRNIEEHASADVEKMILG NKCDVNDKRQVSKERGEKLALDYGIKFMETSAKANINVENAFFTLARDIKAKMDKKLEGN SPQGSSHGVKITVEQQKRTSFFRCSLL NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atggcgaagacctacgattacctgttcaagctgctgctgatcggggactcgggggtaggg aagacctgtgtcctgttccgcttctccgaggacgccttcaactccacattcatctccacc ataggaattgactttaaaattaggaccatagagctcgatggcaagaggattaaactgcag atatgggacacggccggccaggagcgatttcgaacaatcaccacagcctactacaggggt gccatgggtatcatgctggtctacgacattaccaatgagaagtcctttgacaacatccgg aattggattcggaacattgaagagcatgcctctgcagacgtggagaagatgatacttggg aataagtgtgatgtgaatgacaagagacaggtgtccaaggaacggggagaaaagctggca ctcgactatgggatcaagttcatggagaccagtgcgaaggccaacatcaatgtggagaac gcatttttcactcttgccagggacatcaaagcaaaaatggacaaaaaattggaagggaac agtccccaggggagcagccatggagtcaagatcacagtggaacagcagaagaggaccagc ttcttccggtgcagtctcctgtga

DBGET integrated database retrieval system