KEGG   Mus pahari (shrew mouse): 110336584
Entry
110336584         CDS       T05929                                 

Gene name
Bbc3
Definition
(RefSeq) bcl-2-binding component 3
  KO
K10132  Bcl-2-binding component 3
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01524  Platinum drug resistance
mpah04115  p53 signaling pathway
mpah04210  Apoptosis
mpah04215  Apoptosis - multiple species
mpah04390  Hippo signaling pathway
mpah05016  Huntington disease
mpah05162  Measles
mpah05200  Pathways in cancer
mpah05210  Colorectal cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04390 Hippo signaling pathway
    110336584 (Bbc3)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110336584 (Bbc3)
   04215 Apoptosis - multiple species
    110336584 (Bbc3)
   04115 p53 signaling pathway
    110336584 (Bbc3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110336584 (Bbc3)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110336584 (Bbc3)
  09172 Infectious disease: viral
   05162 Measles
    110336584 (Bbc3)
  09164 Neurodegenerative disease
   05016 Huntington disease
    110336584 (Bbc3)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110336584 (Bbc3)
SSDB
Motif
Pfam: PUMA
Other DBs
NCBI-GeneID: 110336584
NCBI-ProteinID: XP_021074886
Ensembl: MGP_PahariEiJ_G0021087
LinkDB
Position
19
AA seq 193 aa
MARARQEGSSPEPVEGLARDSPRPFPLGRLMPSAVSCSLCEPGLPAAPAAPALLPAAYLC
APTAPPAVTAALGGPRWPGGHRTRPRSPRPDGPQPSLSPAQQHLESPVPSAPEALAGGPT
QAAPGVRVEEEEWAREIGAQLRRMADDLNAQYERRRQEEQHRHRPSPWRVMYNLFMGLLP
LPRDPGAPEMEPN
NT seq 582 nt   +upstreamnt  +downstreamnt
atggcccgcgcacgccaggagggcagctctccggagcccgtagagggcctggcccgcgac
agtccgcgccccttcccgctcggccgcctgatgccctccgctgtatcctgcagcctctgc
gagcccggcctgcccgccgcccctgctgcccctgccttgctgccggccgcctacctctgc
gcccccaccgccccacctgccgtcaccgccgccctggggggcccccgctggcctgggggt
caccgcacccggccccgaagcccgcgcccggacggtcctcagccctcgctgtcgccagcc
cagcagcacctagagtcgcccgtgcccagcgccccggaggccctggcgggaggccccacc
caagctgccccgggagtgcgtgtggaggaggaggagtgggcccgggagatcggggcccag
ctgcggcggatggcggacgacctcaacgcgcagtacgagcggcggagacaagaagagcag
catcgacaccgaccctcgccctggagggtcatgtacaatctcttcatggggctcctcccc
ttacccagggatccgggagccccagaaatggagcccaactag

DBGET integrated database retrieval system