KEGG   Mus pahari (shrew mouse): 110336811
Entry
110336811         CDS       T05929                                 
Symbol
Plaur
Name
(RefSeq) urokinase plasminogen activator surface receptor
  KO
K03985  plasminogen activator, urokinase receptor
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04610  Complement and coagulation cascades
mpah05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09150 Organismal Systems
  09151 Immune system
   04610 Complement and coagulation cascades
    110336811 (Plaur)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    110336811 (Plaur)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110336811 (Plaur)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
    110336811 (Plaur)
CD molecules [BR:mpah04090]
 Proteins
  110336811 (Plaur)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:mpah00537]
 Receptors
  110336811 (Plaur)
SSDB
Motif
Pfam: UPAR_LY6 UPAR_LY6_2
Other DBs
NCBI-GeneID: 110336811
NCBI-ProteinID: XP_021075217
Ensembl: MGP_PahariEiJ_G0021186
LinkDB
Position
19:19980161..19994801
AA seq 334 aa
MGFPRWRLLLLLLLLLLATTCVPASQGLQCMQCESNQNCLVEECAPGQDLCRTTVLQEWQ
DDEELEVVTRGCAHSEKTNRTMSYRMGSMIISLTETVCATNLCNRIIPGARGRGRAFPQG
RYLECASCTSLDQSCERGRELSLQCRYPAEHCIEVVTLQNTERSSKDEDYTRGCGSLPGC
PGTAGFHSNQTFHFLKCCNHTHCNGGPVLDLQSFPPNGFQCYSCEGNNTLGCSSEEASLI
DCRGPMNQCLVATGLDGLGKRSYTIRGCATASWCQGSHMADAFLPTHLNVSVSCCSGSGC
NSPTGGAPRPGSAHLSLMASLLLTLRLWGVLLWT
NT seq 1005 nt   +upstreamnt  +downstreamnt
atgggcttcccgaggtggcggctgctgctgctgctgctgctgctgctgctggcaacgacc
tgtgtcccagcctcccagggcctacagtgcatgcagtgtgagagtaaccagaactgcctg
gtggaggagtgtgccccgggccaggacctctgcaggaccacagtgcttcaggaatggcaa
gatgatgaagagctggaggtggtgacaagaggctgtgcccacagcgaaaagaccaacagg
accatgagctaccgcatgggctccatgatcatcagcctgacagagaccgtgtgtgccaca
aacctctgcaacaggatcatacctggagcccgaggccgaggccgcgccttcccccagggc
cgttaccttgagtgtgcgtcctgcacctctttggaccagagctgtgagaggggccgggag
ctaagcctgcaatgccgctatcctgcagagcactgtatcgaagtggtgaccctccagaac
acagaaaggagctcgaaggatgaggactacacccgaggctgtggcagtcttcccggatgc
ccaggcacagcaggtttccatagcaaccagacctttcacttcttgaagtgttgcaaccac
acccactgcaatggtggcccagttctggatcttcagagctttccaccgaatggcttccag
tgttacagctgtgaggggaacaatacccttgggtgttcctccgaagaggcgtctctcatc
gactgccggggaccaatgaatcagtgcctggtggctacaggcttggatgggctgggaaag
cggagttacaccataagaggctgtgccacggcttcctggtgccaaggctcccacatggca
gacgccttcctcccgacccacctcaacgtctccgtctcctgctgcagcggcagtggctgt
aacagccccacggggggcgcccccaggccaggctctgctcatctcagcctcatggcctct
ctgctcctgaccctcagactatggggcgtcctcctctggacctga

DBGET integrated database retrieval system