KEGG   Mus pahari (shrew mouse): 110337287
Entry
110337287         CDS       T05929                                 
Symbol
Glg1
Name
(RefSeq) Golgi apparatus protein 1 isoform X1
  KO
K06816  golgi apparatus protein 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110337287 (Glg1)
SSDB
Motif
Pfam: Cys_rich_FGFR DUF2722
Other DBs
NCBI-GeneID: 110337287
NCBI-ProteinID: XP_021075774
Ensembl: MGP_PahariEiJ_G0023171
LinkDB
Position
20:complement(34525017..34620795)
AA seq 1179 aa
MAVCGRVRGMFRLSAALPLLLLAAAGAQNGLGQGQGPGANFGPFQGQGGGGSPAGQQQPQ
LSQQQQQQPPPQQQQQPQQQQQPQQQSLFLAGGLPARRGGAGPGGTGGGWKLAEEESCRE
DVTRVCPKHTWSNNLAVLECLQDVREPENEISSDCNHLLWNYKLNLTTDPKFESVAREVC
KSTISEIKECAEEPVGKGYMVSCLVDHRGNITEYQCHQYITKMTAIIFSDYRLICGFMDD
CKNDINLLKCGSIRLGEKDAHSQGEVVSCLEKGLVKEAEEKEPKTQVSDRCRKAILRVAE
LSSDDFHLDRHLYFACRDDRERFCENTQAGEGRVYKCLFNHKFEESMSEKCREALTTRQK
LIAQDYKVSYSLAKSCKSDLKKYRCNVENLPRSREARLSYLLMCLESAVHRGRQVSSECQ
GEMLDYRRMLMEDFSLSPEIILSCRGEIEHHCSGLHRKGRTLHCLMKVVRGEKGNLGMNC
QQALQTLIQETDPGADYRIDRALNEACESVIQTACKHIRSGDPMILSCLMEHLYTEKMVE
DCEHRLLELQYFISRDWKLDPVLYRKCQGDASRLCHTHGWNETSELMPPGAVFSCLYRHA
YRTEEQGRRLSRECRAEVQRILHQRAMDVKLDPALQDKCLIDLGKWCSEKTETGQELECL
QDHLDDLAVECRDIVGNLTELESEDIQIEALLMRACEPIIQNFCHDVADNQIDSGDLMEC
LIQNKHQKDMNEKCAIGVTHFQLVQMKDFRFSYKFKMACKEDVLKLCPNIKKKVDVVICL
STTVRNDTLQEAKEHRVSLKCRRQLRVEELEMTEDIRLEPDLYEACKSDIKNYCSTVQYG
NAQIIECLKENKKQLSTRCHQKVFKLQETEMMDPELDYTLMRVCKQMIKRFCPEADSKTM
LQCLKQNKNSELMDPKCKQMITKRQITQNTDYRLNPVLRKACKADIPKFCHGILTKAKDD
SELEGQVISCLKLRYADQRLSSDCEDQIRIIIQESALDYRLDPQLQLHCSDEIANLCAEE
AAAQEQTGQVEECLKVNLLKIKTELCKKEVLNMLKESKADIFVDPVLHTACALDIKHHCA
AITPGRGRQMSCLMEALEDKRVRLQPECKKRLNDRIEMWSYAAKVAPADGFSDLAMQVMT
SPSKNYILSVISGSICILFLIGLMCGRITKRVTRELKDR
NT seq 3540 nt   +upstreamnt  +downstreamnt
atggcggtgtgtggacgtgtacgggggatgttccgcttgtcggcggcgttgccgctgctg
ctgctcgcggcggcaggggcccagaacggcctcggtcagggccagggtccgggggccaac
tttgggcctttccagggccaaggtggaggcggcagcccggccgggcagcagcagcctcag
ttatcgcagcagcagcagcagcagccgccgcctcagcagcagcagcagccccagcagcag
cagcagccccagcagcagtctcttttcctggcgggcgggctcccggcccggcggggcgga
gcggggcccggtgggactggcggaggctggaagctggcggaggaagagtcctgccgggag
gacgtgacccgtgtgtgccccaaacacacctggagcaacaacctggcggtgctcgagtgc
ctgcaggacgtgagggagcccgagaacgagatttcttcagactgcaatcatttgctgtgg
aattacaagctgaacctgactacggatcccaaatttgaatctgtggccagggaggtttgc
aagtcaactatttccgagattaaagaatgtgcagaagaaccagttggaaaaggttacatg
gtttcctgcttggtggatcaccgcggcaacatcactgagtatcagtgtcatcaatacatt
accaaaatgacagccatcattttcagtgattaccgcctgatctgcggcttcatggatgac
tgcaaaaacgatatcaacctcttgaaatgcggcagcattcgtcttggggaaaaggatgca
cattcacaaggtgaggtggtgtcgtgtttggaaaaaggcctggtgaaagaggcagaagaa
aaagagcccaagactcaagtctcagatcgctgcaggaaagccatcctgagggtggcggag
ctgtcgtcggatgacttccatctggaccggcacttgtattttgcttgccgagatgaccgg
gagcgcttttgtgagaacacacaagctggtgaaggaagagtgtataaatgcctttttaac
cataaatttgaagaatccatgagtgaaaagtgtagagaagcactaactacacgccaaaag
ctcattgcccaggattataaagtcagttattcattggccaaatcctgtaagagtgacttg
aaaaaataccggtgcaatgtggaaaaccttcctcggtcccgggaagccaggctctcctac
cttctgatgtgcctggagtcagcagtgcacagagggcggcaggtaagcagtgagtgccaa
ggtgagatgctggattaccgacgcatgctgatggaagacttctctctgagccccgagatc
atcctgagctgtcgaggggagattgaacaccactgttctggattacatcggaaagggcga
accctccactgtctgatgaaagtagttcggggtgagaaggggaaccttggaatgaactgc
cagcaggcgcttcagacactgattcaggagacggaccccggtgcagactaccgcattgat
cgagctttgaatgaagcttgtgagtctgtaatacagacagcctgcaagcacatacgatcc
ggagacccaatgattctttcatgtctgatggagcatttatacacagagaagatggtggaa
gactgtgaacaccgtctcttagagctacagtattttatctctcgggattggaagttggac
cctgttttataccgaaaatgccagggagatgcttcccgcctttgccatacccatggctgg
aatgagaccagtgaacttatgcctcctggagctgtgttttcttgcctatacagacatgcc
taccgcacagaagagcaaggaaggaggctctcacgagaatgtcgagctgaagtccagagg
atcctgcaccagcgagccatggatgttaagctggatcctgccctccaggacaagtgcctc
atagacctagggaagtggtgcagtgagaagacggagaccgggcaggagcttgagtgcctt
caggaccatctggatgacttagctgtggaatgcagagacatcgtgggcaacctcaccgag
ttggagtccgaggatatacaaatagaagctttgctgatgagagcctgtgagcctataatt
cagaacttttgccatgatgtggcagacaaccagatcgactctggggacctgatggagtgt
ctgatccagaacaagcaccagaaggacatgaacgagaagtgtgccattggtgtcactcac
ttccagctggtacagatgaaggattttcgattctcttacaagttcaaaatggcctgcaaa
gaggatgtgttaaagctttgccccaacataaagaagaaggtggacgtcgtgatctgcctg
agcaccaccgtgcgcaacgacactctgcaggaagccaaggagcaccgggtgtcactcaag
tgccgcaggcagctccgtgtggaagagctggagatgacagaggacatccgtttggaacca
gatctgtacgaagcctgcaagagtgacatcaagaactactgttctacagtgcaatatgga
aatgctcagattattgaatgtctaaaagaaaacaagaagcagctgagtacccgttgccac
cagaaagtatttaagctgcaggagacggagatgatggacccagagctagactatactctg
atgcgagtctgcaagcagatgattaagcggttctgtccagaagcagattctaaaactatg
ttgcagtgtttaaaacaaaataagaacagtgaattgatggatcccaaatgcaaacagatg
ataaccaagcgtcagatcacccagaacacagattaccgcttaaaccctgtgctgaggaag
gcctgtaaagctgacattcctaagttctgtcacggtatcctgactaaggccaaggatgat
tcagagctagaaggccaagttatctcatgcctcaagctgagatatgctgaccagcgcctg
tcttcagactgtgaggaccagatccgcatcatcatccaggagtctgcgctggattaccgc
ctggaccctcagctccagctgcactgctcagatgagattgccaatctatgtgctgaagaa
gcagcagcccaggagcaaacaggccaagtagaagagtgcctgaaggtcaacctgctcaag
atcaagacagagctgtgtaaaaaggaagtgttaaacatgttgaaggaaagcaaagcagac
atctttgtggacccagttcttcacacagcatgtgccttggacattaaacaccactgtgca
gccatcacccctggccgtgggcgtcagatgtcctgcctgatggaggccctggaagataag
cgagtgaggttgcagccagagtgcaaaaagcgcctcaatgaccggattgaaatgtggagt
tacgcagccaaggtggctccagcagatggcttctctgatcttgccatgcaagtgatgacg
tcaccctcaaagaactacatcctgtctgtgatcagcgggagcatctgcatactgttcctg
attggcctgatgtgtggacggatcaccaagagagtgacgcgagagctgaaagacaggtag

DBGET integrated database retrieval system