KEGG   Mus pahari (shrew mouse): 110337298
Entry
110337298         CDS       T05929                                 
Symbol
Cdh3
Name
(RefSeq) cadherin-3 isoform X1
  KO
K06796  cadherin 3, type 1, P-cadherin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110337298 (Cdh3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mpah04515]
    110337298 (Cdh3)
Cell adhesion molecules [BR:mpah04515]
 Cadherins
  Major cadherins
   110337298 (Cdh3)
SSDB
Motif
Pfam: Cadherin CADH_Y-type_LIR Cadherin_3 BACON_2 Big_9 Calycin_like
Other DBs
NCBI-GeneID: 110337298
NCBI-ProteinID: XP_021075799
Ensembl: MGP_PahariEiJ_G0023120
LinkDB
Position
20:29917693..29962911
AA seq 822 aa
MELLSGPLAFLLLLLQVCWLRSVVSEPYRAGFIGEAGVTLEVEGTDLERSHALGKVALAG
QEMHHADNGEIAVLKRGAVQGGEDAMSSPPTRILKRRKREWVMPPISVPENGKGPFPQRL
NQLKSNKDRGTKIFYSITGPGADSPPEGVFTIEKESGWLLLHMPLDREKIVKYELYGHAV
SENGASVEEPMNISIIVTDQNDNKPKFTQDTFRGSVLEGVMPGTSVMQVTATDEDDAVNT
YNGVVAYSIHSQEPKEPHDLMFTIHKSTGTISVISSGLDREKVPEYRLTVQATDMDGEGS
TTTAEAIVQILDANDNAPEFEPQKYEAWVPENEVGHEVQRLTVTDLDVPNSPAWRATYHI
VGGDGGDHFTITTHPETNQGVLTTKKGLDFEAQDQHTLYIEVTNEAPFAVKLPTATATVV
VHVKDVNEAPAFVPPSKVIEAQEGISIGELVCVYTAQDPDKEEQKISYTISRDPANWLAV
DPDSGQITAAGILDREDEQFVKNNVYEVLVLATDNGNPPTTGTGTLLLTLTDINDHGPIP
EPRQIIICNQSPVPQVLNITDKDLSPNSAPFQAQLTHDSDIYWMADVSEKGDTVALSLKK
FLKQDTYDLHLSLSDHGNREQLTMIRATVCDCHGQVFNDCPRPWKGGFILPILGAVLALL
ILLLALLLLVRKKRKVKEPLLLPEDDTRDNVFYYGEEGGGEEDQDYDITQLHRGLEARPE
VVLRNDVVPTFIPTPMYRPRPANPDEIGNFIIENLKAANTDPTAPPYDSLLVFDYEGSGS
DAASLSSLTSSASDQDQDYNYLNEWGSRFKKLADMYGGGEDD
NT seq 2469 nt   +upstreamnt  +downstreamnt
atggagcttcttagtgggcctctcgccttcctgctcctcctgctccaggtttgctggcta
cgcagcgtggtctccgagccctaccgggcgggcttcatcggggaggctggagtgaccttg
gaggtggaaggaactgacctggagcggagccacgcgctggggaaagtagccttggctgga
caggagatgcaccatgcagacaatggagaaatcgctgtgctgaaaaggggggcagttcag
ggaggggaggatgcaatgagctccccacccacacgcatcttaaagagacggaagagagag
tgggtaatgccgccgatatccgtccctgagaatggcaagggtcccttccctcagaggctg
aatcagctcaaatcgaataaggacagaggcaccaagattttctacagcatcacagggcct
ggtgcagacagtccacccgagggagtcttcaccatcgagaaggagtcaggctggctgctg
ttgcatatgccgctggacagggagaaaattgtcaagtacgagctttatggccacgctgta
tccgagaacggtgcctctgtagaggagcccatgaacatatccatcattgtgacagaccag
aatgacaacaagcccaagttcactcaagataccttcagagggagtgttctggagggggtc
atgcctggcacttctgtgatgcaggtgacagccacagatgaggacgatgccgtcaacact
tacaatggggtggtggcttactccatccatagccaagagccgaaggagccacacgacctc
atgttcaccatccataaaagcacggggaccattagcgtcatttccagtggcctggaccga
gagaaagtccctgagtatagactgaccgtccaggccacagacatggatggagagggctct
accacaacggcagaggccattgtgcagatccttgatgccaacgataatgctccggagttt
gagccgcagaagtatgaggcttgggtgcctgagaacgaagtgggccatgaggtacagaga
ctgacagtgactgatctcgatgtccccaactcgccagcgtggcgtgccacctaccacatc
gtgggaggtgacggtggggaccatttcaccatcaccactcacccagagaccaaccaaggc
gtcctgacaaccaagaagggtttggattttgaggctcaggaccaacacaccctgtacata
gaagtgaccaacgaggctccctttgcagtgaagctcccgacggccactgccaccgtggtg
gtccacgtgaaagatgtcaacgaagcccctgcgtttgttccaccttccaaggtcattgag
gcccaggaaggcatctctattggggaactggtctgcgtctataccgcacaggacccagac
aaggaggaacagaagatcagctacaccatctcgagagacccagccaactggcttgctgtg
gacccagacagtggtcagataactgccgcaggcatcttagatcgtgaggacgagcagttt
gtgaaaaacaacgtctacgaagtcctggttttggccacagacaatggaaaccctcccacc
actggcactgggaccctcctgctaacacttactgacatcaacgaccatggcccgatccct
gaaccccggcagatcatcatctgtaaccaaagccctgtgcctcaagtgctgaacatcacc
gacaaggacctgtcccctaactccgcccctttccaggcccagctaacacatgactcggac
atctactggatggcagacgtcagtgagaaaggagacaccgtggccttgtccctgaagaag
ttcctgaaacaagacacgtatgacttgcacctttctttgtctgaccatggcaacagggaa
cagctaaccatgatcagggccactgtgtgtgactgccatggccaagtgttcaatgactgc
cccagaccctggaagggtggtttcatcctccccatcctgggtgctgtcctggcactgctg
atccttctgctggctctcctcctgttggtgaggaagaagaggaaggtcaaagagcccctt
ctgctcccagaggatgacactcgtgacaatgtcttctattacggagaagagggtggtggc
gaagaggatcaggactatgacatcacccaactccaccggggactggaggccaggcctgag
gtggttctccgaaacgacgtagtgccaaccttcatccccacccccatgtaccgacccagg
cccgccaacccagatgaaatcgggaacttcatcattgagaacctgaaggctgccaacact
gaccctactgccccgccctacgactccctgctggtgtttgactacgagggcagcggctct
gacgccgcctccctgagctccctcacctcctccgcctccgaccaggaccaggactacaac
taccttaacgagtggggaagtcgattcaagaaactggcggacatgtatggtggcggtgag
gatgactag

DBGET integrated database retrieval system