KEGG   Mus pahari (shrew mouse): 110337332
Entry
110337332         CDS       T05929                                 
Symbol
Cdh5
Name
(RefSeq) cadherin-5
  KO
K06533  cadherin 5, type 2, VE-cadherin
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah04670  Leukocyte transendothelial migration
mpah05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110337332 (Cdh5)
 09150 Organismal Systems
  09151 Immune system
   04670 Leukocyte transendothelial migration
    110337332 (Cdh5)
 09160 Human Diseases
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    110337332 (Cdh5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04515 Cell adhesion molecules [BR:mpah04515]
    110337332 (Cdh5)
   04090 CD molecules [BR:mpah04090]
    110337332 (Cdh5)
Cell adhesion molecules [BR:mpah04515]
 Cadherins
  Major cadherins
   110337332 (Cdh5)
CD molecules [BR:mpah04090]
 Proteins
  110337332 (Cdh5)
SSDB
Motif
Pfam: Cadherin CADH_Y-type_LIR Cadherin_3 Cadherin_2 Stevor
Other DBs
NCBI-GeneID: 110337332
NCBI-ProteinID: XP_021075859
Ensembl: MGP_PahariEiJ_G0023035
LinkDB
Position
20:27666558..27707216
AA seq 784 aa
MQRLTELATALGAFLGLLAVAAMAGPNFPQIDTHNMLPAHHRQKRDWIWNQMHIDEEKNE
SLPHYVGKIKSNVNRQNAKYVLQGEFAGKIFGVDANTGSVLAYERLDREKVSEYFLTALI
VDKNTNENLEQPSSFTVKVHDINDNWPVFSHRVFNASVPEMSAIGTSVIRVTAVDADDPT
VAGHATVLYQIVKGNEYFSIDNSGLIFTKTKNLDRERQAEYKIVVETQDALGLRGESGTA
TVLIRLEDINDNFPIFTQSTYTFSVPEDIRVGKPLGFLTVVDPDEPQNRMTKYSITQGEH
RDTFTIETDPKRNEGIIKPTKSLDYEVIQKYTFYIEATDPTIRFEYLSSTAGKNKAKVTI
NVLDVDEPPVFQQHFYHFKLPENQKKPLIGTVVAKDPDKARRSIGYSIRKASDRGQFFRI
TKQGDIYNEKELDRETHAWYNLTVEANELDSRGNPVGKESIVQVHIEVLDENDNPPEFAQ
PYEPKVCENAAQGKLVIQISATDKDAVPVNPKFKFALKNEDSNFTLINNHDNTANITVKY
GQFNREHTKFHYLPVLISDNGVPSLTGTSTLTVGVCKCNEQGEFTFCEEMAAQAGVSIQA
LVAIFLCILTITVITLLIILRRRLRKQAHAHSKSALEIHEQLVTYDEEGGGEMDTTSYDV
SVLNSVRGGSTKPLRSTMDARPAVYTQVQKPPRLAPGLHGGPREMATMIDVKKEEADNDG
GGPPYDTLHIYGYEGAESIAESLSSLSTNSSDSDIDYDFLNDWGPRFKMLAELYGSDPQE
ELII
NT seq 2355 nt   +upstreamnt  +downstreamnt
atgcagaggctcacagagctggccacggctctgggcgccttcctgggcctcctggcagtg
gcagcaatggcaggccctaactttccccagatagacacccacaacatgctgcctgcccac
catcgccaaaagagagactggatttggaatcaaatgcacatcgatgaggagaaaaatgaa
tcgctgccccactatgtgggaaagatcaagtccaacgtgaaccgccagaatgctaagtat
gtgctccaaggagagtttgctggcaagatcttcggggtcgatgctaacacagggagtgtg
cttgcctatgagaggttagaccgggagaaagtctccgagtacttccttactgccctcatt
gtggacaagaataccaacgaaaacctggagcaaccttccagcttcacggtcaaggtgcat
gacataaatgacaattggcctgtgttttcccaccgagtattcaacgcatctgtgccagag
atgtcagctatagggacctctgtcatccgtgtgacagcagtggacgcagatgaccccact
gtggcaggccacgccactgttctgtaccaaatcgtgaaaggaaatgagtacttcagcatt
gataattctggactcatcttcacaaagaccaaaaacttggaccgagagagacaggctgaa
tacaagatcgtggtggaaacgcaagatgccttgggtctgcggggagagtcgggcacagcc
acggtgctgatcaggctggaagacatcaatgacaacttccccatctttactcagtccaca
tacacattttcggtgcctgaagatatccgtgtgggcaagcccttgggctttctgactgtt
gtggacccagatgagccccagaaccggatgaccaagtacagcatcactcagggcgagcac
agggacaccttcaccattgagacagaccccaaacgtaacgagggcatcatcaaacccacg
aagtccctggactatgaagtcatccagaagtacacgttctacattgaggccacagacccc
actatccgattcgaatacctgagcagcactgcaggcaaaaacaaagccaaggtcaccatc
aacgtccttgacgtggatgagccccctgtcttccagcaacacttctaccacttcaagctg
ccagaaaaccagaagaaaccactgatcggcactgtggtggccaaagaccctgacaaggct
cggcgcagcatcggatactccatccgcaaggccagtgacagaggccagttcttccgaata
accaaacagggggacatctataacgagaaagaactggacagagaaacccacgcctggtat
aatctgaccgtggaggccaacgaactggattctaggggtaaccctgtaggtaaagaatcc
attgtgcaggttcacattgaagttttggatgaaaacgacaatcctccggaatttgcccag
ccctatgaacctaaagtgtgtgagaatgctgcccagggcaagctggtaatacagatctct
gcaacagacaaggacgcggtgccagtaaacccaaagttcaagtttgccctgaagaacgag
gacagcaacttcaccctcataaacaaccacgacaacaccgccaacatcacggtcaagtat
gggcagtttaatcgggagcataccaagttccactacctgcccgtgcttatctcagacaac
ggggtgcccagcctgactggaaccagcacgctaaccgtgggtgtgtgcaagtgcaacgag
caaggcgagttcaccttctgtgaggagatggcagcccaggcgggcgtcagcatccaggcg
ctggtggccatctttctctgcatcctcaccatcacagtgatcaccttgctgatcatcctg
cggaggcggctccggaagcaggcgcatgctcatagcaagagtgcactggagattcacgag
cagctggtcacctacgatgaggagggcggtggcgagatggacaccaccagctacgacgtg
tcagtgcttaattctgtgcgcggtggctccaccaagcccctgcgctccacgatggacgcc
cggccggcagtgtacacgcaggtgcagaagccgccgcgcctggcgcctggactgcacgga
gggcccagggagatggccaccatgatcgacgtgaagaaagaagaggcagacaatgacggc
ggtggccccccgtatgacacactgcacatctacggctacgagggcgccgaatccatcgca
gagtccctcagttccctgagcaccaattcctccgactctgacatcgactatgacttcctc
aacgactggggacccaggttcaagatgctggctgagctgtacggctcagatccccaggaa
gagctcatcatctag

DBGET integrated database retrieval system