KEGG   Mus pahari (shrew mouse): 110337499
Entry
110337499         CDS       T05929                                 

Gene name
Hhip
Definition
(RefSeq) hedgehog-interacting protein
  KO
K06231  hedgehog interacting protein
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04024  cAMP signaling pathway
mpah04340  Hedgehog signaling pathway
mpah05200  Pathways in cancer
mpah05217  Basal cell carcinoma
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    110337499 (Hhip)
   04024 cAMP signaling pathway
    110337499 (Hhip)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110337499 (Hhip)
  09162 Cancer: specific types
   05217 Basal cell carcinoma
    110337499 (Hhip)
SSDB
Motif
Pfam: Folate_rec GSDH EGF_2
Other DBs
NCBI-GeneID: 110337499
NCBI-ProteinID: XP_021076116
Ensembl: MGP_PahariEiJ_G0022859
LinkDB
Position
20
AA seq 700 aa
MLKMLSFKLLLLAVALGFFEGDAKFGERSEGSGARRRRCLNGNPPKRLKRRDRRVMSQLE
LLSGGEILCGGFYPRVSCCLQSDSPGLGRLENKIFSATNNSECSRLLEEIQCAPCSPHSQ
SLFYTPERDVLDGDLALPLLCKDYCKEFFYTCRGHIPGLLQTTADEFCFYYARKDAGLCF
PDFPRKQVRGPASNYLGQMEDYEKVGGISRKHKHNCLCVQEVMSGLRQPVSAVHSGDGSH
RLFILEKEGYVKILTPEGELFKEPYLDIHKLVQSGIKGGDERGLLSLAFHPNYKKNGKLY
VSYTTNQERWAIGPHDHILRVVEYTVSRKNPHQVDVRTARVFLEVAELHRKHLGGQLLFG
PDGFLYIILGDGMITLDDMEEMDGLSDFTGSVLRLDVDTDMCNVPYSIPRSNPHFNSTNQ
PPEVFAHGLHDPGRCAVDRHPTDININLTILCSDSNGKNRSSARILQIIKGRDYESEPSL
LEFKPFSNGPLVGGFVYRGCQSERLYGSYVFGDHNGNFLTLQQSPVTKQWQEKPLCLGAS
SSCRGYFSGHILGFGEDELGEVYILSSSKSVTQTHNGKLYKIVDPKRPLMPEECRVTVQP
AQTLTSDCSRLCRNGYYTPTGKCCCSPGWEGDFCRLAKCEPACRHGGVCVRPNKCLCKKG
YLGPQCEQVDRNVRRVTRAGILDQIIDMTSYLLDLTSYIV
NT seq 2103 nt   +upstreamnt  +downstreamnt
atgctgaagatgctctcgtttaaactgctactgctggccgtggctctgggcttctttgaa
ggagatgcgaagtttggggaaaggagcgaagggagcggagcgagaaggagaaggtgcctg
aatgggaaccccccaaagcgcctaaaaagaagggacaggcgggtgatgtcccagctggag
ctgctcagtggaggagaaatcctgtgtggtggcttctacccacgagtatcttgctgcctg
cagagtgacagccctggattggggcgtctggagaacaagatcttttctgccaccaacaac
tcagaatgcagcaggctgcttgaggagatccaatgtgctccctgctccccccattcccag
agcctcttctacacacccgaaagagatgtcctggatggggacctcgcacttcccctcctc
tgcaaggactactgcaaagaattcttttatacttgtcggggccatattccaggtcttctt
caaacaactgctgatgaattttgcttttactatgcaagaaaagatgctgggttatgcttt
ccagacttcccgagaaagcaagtcagaggaccagcatctaactacttgggccagatggaa
gactatgagaaagtggggggaatcagcagaaaacacaaacacaactgcctctgtgtccag
gaggtcatgagtgggctgcggcagcctgtgagcgctgtgcacagcggggatggctcccat
cggctcttcattctagagaaggaaggctacgtgaagattctaaccccagaaggagaactg
ttcaaggagccttacttggacattcacaaacttgttcaaagtggaataaagggaggagac
gaaaggggcctgctaagtctggcattccatcccaattacaagaaaaatggaaagctgtat
gtgtcttataccaccaaccaggaacggtgggctatcgggcctcacgaccacattcttagg
gttgtggaatacacagtatccaggaaaaatccccatcaagttgatgtgagaacagccagg
gtgtttctggaagtcgctgagctccatcgaaagcatcttgggggacagctgctctttggt
cccgatggctttttgtacatcatccttggggatggtatgatcacattggatgacatggaa
gagatggatgggttaagtgacttcacaggctctgtgctgaggctggacgtggacaccgac
atgtgcaatgtgccttattccataccacggagtaacccgcacttcaacagcaccaaccag
cccccagaagtatttgctcacggtctccatgatccaggcagatgtgccgtggatcgacat
cccactgatataaacatcaatttaacaatactttgctcagattccaacgggaaaaacagg
tcatcagccagaatcctacagataataaagggaagagattatgaaagtgagccatctctt
cttgaattcaagccattcagtaacggccctttggtgggtggatttgtttacagaggctgt
caatctgaaagattgtatggaagctatgtgtttggagatcacaatgggaatttcttaacc
ctccagcaaagcccagtgaccaagcaatggcaagaaaagccgctctgtctgggcgccagc
agctcctgtcgaggctacttttcgggtcacatcttgggatttggagaagatgaattagga
gaggtttacattctatcaagcagtaagagtgtgacccagactcacaatggaaagctctac
aagatcgtagaccccaaaagacctttaatgcctgaggaatgcagagtcacagttcagcct
gcccagacactgacctcggattgctcccggctctgtcggaatggttactacacccctact
ggcaagtgctgctgcagtccgggctgggaaggagacttctgcagacttgccaagtgtgag
ccagcgtgccgtcatggaggtgtctgtgtcagaccaaacaagtgcctctgtaaaaagggc
tatctcggtcctcaatgtgaacaagtggacaggaacgtccgcagagtgaccagggcaggt
atccttgatcagatcattgacatgacatcttacttgctggatctcacaagttacattgta
tag

DBGET integrated database retrieval system