KEGG   Mus pahari (shrew mouse): 110337655
Entry
110337655         CDS       T05929                                 

Gene name
Pard3
Definition
(RefSeq) partitioning defective 3 homolog isoform X1
  KO
K04237  partitioning defective protein 3
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04015  Rap1 signaling pathway
mpah04062  Chemokine signaling pathway
mpah04080  Neuroactive ligand-receptor interaction
mpah04144  Endocytosis
mpah04360  Axon guidance
mpah04390  Hippo signaling pathway
mpah04520  Adherens junction
mpah04530  Tight junction
mpah05165  Human papillomavirus infection
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110337655 (Pard3)
   04390 Hippo signaling pathway
    110337655 (Pard3)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    110337655 (Pard3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    110337655 (Pard3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    110337655 (Pard3)
   04530 Tight junction
    110337655 (Pard3)
 09150 Organismal Systems
  09151 Immune system
   04062 Chemokine signaling pathway
    110337655 (Pard3)
  09158 Development and regeneration
   04360 Axon guidance
    110337655 (Pard3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    110337655 (Pard3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:mpah01009]
    110337655 (Pard3)
Protein phosphatases and associated proteins [BR:mpah01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     110337655 (Pard3)
SSDB
Motif
Pfam: Par3_HAL_N_term PDZ PDZ_6 PDZ_2 TSGP1
Other DBs
NCBI-GeneID: 110337655
NCBI-ProteinID: XP_021076348
Ensembl: MGP_PahariEiJ_G0023330
LinkDB
Position
20
AA seq 1337 aa
MKVTVCFGRTRVVVPCGDGRMKVFSLIQQAVTRYRKAVAKDPNYWIQVHRLEHGDGGILD
LDDILCDVADDKDRLVAVFDEQDPHHGGDGTSASSTGTQSPELFGSELGTNNVSAFQPYQ
ATSEIEVTPSVLRANMPLHVRRSSDPALTGLSTSISDNNFSSEEPSRKNPTRWSTTAGFL
KQNTAGSPKTCDRKKDENYRSLPRDPSSWSNQFQRDNARSSLSASHPMVDRWLEKQEQDE
EGTEEDSSRVEPVGHADTGLENMPNFSLDDMVKLVQVPNDGGPLGIHVVPFSARGGRTLG
LLVKRLEKGGKAEQENLFHENDCIVRINDGDLRNRRFEQAQHIFRQAMRARVIWFHVVPA
ANKEQYEQLSQREKNNYSPGRFSPDSHCVANRSVANNAPQALPRAPRLSQPPEQLDAHPR
LPHSAHASTKPPAAPALAPPSVLSTSVGSVYNTKKVGKRLNIQLKKGTEGLGFSITSRDV
TIGGSAPIYVKNILPRGAAIQDGRLKAGDRLIEVNGVDLAGKSQEEVVSLLRSTKMEGTV
SLLVFRQEEAFHPREMNAEPSQMQTPKETKAEDEDVVLTPDGTREFLTFEVPLNDSGSAG
LGVSVKGNRSKENHADLGIFVKSIINGGAASKDGRLRVNDQLIAVNGESLLGKANQEAME
TLRRSMSTEGNKRGMIQLIVARRISRCNELRSPGSPAAPELPIETELDDRERRISHSLYS
GIEGLDESPTRNAALSRIMGESGKCQLSPTVNMPHDDTVMIEDDRLPVLLPHLSDQSSSS
SHDDVGFIMTEAGTWAKATISDSADCSLSPDVDPVLAFQREGFGRQSMSEKRTKQFSDAS
QLDFVKTRKSKSMDLGIADETKLNTVDDQRAGSPSRDVGPSLGLKKSSSLESLQTAVAEV
TLNGNIPFHRPRPRIIRGRGCNESFRAAIDKSYDKPMVDDDDEGMETLEEDTEESSRSGR
ESVSTSSDQPSYSLERQMNGDPEKRDKTERKKDKAGKDKKKDREKEKDKLKAKKGMLKGL
GDMFRFGKHRKDDKMEKMSRIKIQDSFTSEEDRVRMKEEQERIQAKTREFRERQARERDY
AEIQDFHRTFGCDDELLYGGMSSYEGCLALNARPQSPREGHLMDTLYAQVKKPRSSKPGD
SNRSTPSNHDRIQRLRQEFQQAKQDEDVEDRRRTYSFEQSWSSSRPASQSGRHSVSVEVQ
VQRQRQEERESFQQAQRQYSSLPRQSRKNASSISQDSWEQNYAPGEGFQSAKENPRYSSY
QGSRNGYLGGHGFNARVMLETQELLRQEQRRKEQQLKKQPPADGVRGPFRQDVPPSPSQV
ARLNRLQTPEKGRPFYS
NT seq 4014 nt   +upstreamnt  +downstreamnt
atgaaagtgaccgtgtgcttcgggaggacccgggtggtcgtgccgtgcggagatggccgc
atgaaagttttcagcctcatccagcaggcggtgacccgctaccggaaggccgtggccaag
gatccaaactactggatacaggtacatcgcttggaacatggagacggagggattctagac
ctggatgacatcctctgtgacgttgctgatgacaaagacagactggtagcagtgtttgat
gagcaggatccccaccatggaggagatggtaccagcgccagctccacgggaacccagagt
ccagagctattcggcagtgagctgggcaccaacaatgtttctgcttttcagccttatcaa
gccacaagtgaaattgaggtcacgccttcagtccttcgggcaaatatgcctcttcatgtc
cgccggagcagcgatccagctttaactggcctttccacttccatcagtgataacaacttt
tcctcagaggagccctccaggaaaaatcccacccgctggtccacaacagctggctttctc
aagcagaacaccgctggaagtcccaaaacctgtgacaggaagaaagatgaaaactacagg
agccttccacgggatcccagtagctggtccaaccagttccagcgagacaacgcccgatcc
tctctgagtgccagccacccaatggtagaccgttggctggagaagcaagaacaggatgag
gaaggcacagaagaagacagcagccgagtggagccggttggacatgctgatactggattg
gagaacatgcccaacttttccctcgatgatatggtaaagctcgtacaagtccccaacgat
ggagggcccctgggaatccatgtagtgcctttcagtgctcgaggcggcagaacactgggg
ttgttagtgaagcggttggagaaaggtggtaaggctgagcaagaaaaccttttccatgag
aatgactgcattgtgaggattaacgatggagatcttcgaaacagaagatttgagcaagca
caacatatattccgccaagccatgcgtgcgcgtgtcatttggttccacgtggtccctgca
gcaaacaaggagcagtatgaacaactctcccaacgcgagaagaacaactattccccaggc
cgcttcagccctgacagccactgtgtggccaacaggagtgtggccaacaacgcgcctcaa
gcattgcccagagcacccagactcagtcagccacccgagcagctggatgctcacccccga
ctacctcatagtgctcatgcctcaaccaaaccacccgcagccccagccttggctccaccc
agtgtgcttagtaccagtgtaggcagtgtgtacaacacgaagaaagtaggcaagaggctc
aacatccagcttaagaaaggtacagaaggactgggattcagcatcacctcccgggatgtc
accataggtggctcagctcccatttatgtcaagaacatccttcctcgaggggctgccatt
caggatggcagactcaaggcaggagaccggctaatagaggtcaatggagtagatttagca
ggcaaatcccaggaggaagttgtttccctgttgagaagcaccaagatggaggggaccgtg
agccttctggtgtttcgtcaggaagaggctttccacccaagggaaatgaatgctgaacca
agccagatgcagactccaaaagaaacgaaagctgaagatgaggacgttgttctcacaccc
gatggtaccagggagtttctgacttttgaagttccactgaatgactcaggatctgcaggg
cttggcgtcagtgtcaaggggaaccgttccaaagagaaccacgcagatttggggatcttc
gttaagtccattatcaatggtggagctgcatctaaagatggaagactgagggtaaatgat
caactgatagctgtgaatggagagtctcttctgggcaaagccaaccaggaagccatggag
actctacggaggtccatgtccaccgagggcaacaagcgtggcatgatccagctcattgtg
gctaggcggatcagcagatgtaacgagctgcggtcccctgggagccctgctgcacctgag
ctgcccatcgaaacagaactggatgaccgagaacgcaggatctcacactccctctacagt
gggatcgaggggctagatgaatcgcccaccaggaacgccgcactgagcaggataatgggt
gagtcaggtaaatgccagctgtcccccacggtgaacatgcctcacgatgacactgtcatg
attgaagatgacaggctgcctgtgctcctgcctcacctctctgaccagtcctcttccagc
tcccatgatgacgttggattcataatgacagaagcaggcacgtgggccaaagctaccatc
agtgactcagccgactgctcattgagtccagatgttgatccggttctcgcttttcaacgg
gaaggatttggacgccagagtatgtcagaaaaacgcacaaagcaattttcagatgccagt
caattggatttcgttaaaacacgaaaatcaaaaagcatggatttaggtatagctgacgag
actaaactcaatacagtggatgaccagagagcaggctcccccagtagagatgtgggaccc
tccttaggtctgaagaaatccagctccttagaaagtctgcagaccgctgtcgctgaggtg
acgctgaacgggaacattcccttccaccgcccacggccacgaatcatccggggaaggggc
tgcaatgagagcttcagagccgccattgacaagtcctacgataagcccatggttgatgac
gatgacgaaggcatggagaccctggaagaagacacagaggaaagctcgaggtcagggagg
gagtcggtgtccacatccagcgatcagccttcctattctctggagagacaaatgaatgga
gacccagagaaaagggacaagacagagaggaaaaaggacaaagccggaaaggataagaag
aaagaccgagagaaggagaaggataagctgaaagccaagaaggggatgctgaaaggcttg
ggggacatgttcaggtttggcaaacatcgaaaagatgacaagatggaaaaaatgagccga
ataaaaatccaggattctttcacctcagaagaggacagggtgcggatgaaggaagaacag
gaaaggattcaagccaaaactcgagaatttagggagcggcaagcccgagagcgagactat
gccgagatccaagatttccaccggacgtttggctgtgatgacgagttgctgtatgggggc
atgtcatcctatgaaggctgcttggctctcaatgccagaccccagagcccaagagaaggg
cacctgatggacactttgtatgcgcaagtaaagaaacctcggagctccaaacctggagac
agcaatcgatccactcctagcaaccatgaccggatacagcgtctacggcaagagttccag
caagccaaacaggatgaggatgtggaagaccggcgccgtacatacagctttgagcaatct
tggtccagctcacggccggcatcgcagagtggtcgacactcagtgtcagtggaggttcaa
gtacaacggcagcgccaggaggagcgagagagcttccagcaggcccagcgccagtacagt
tcactgccaagacaaagcaggaagaatgccagctccatatcacaggattcctgggaacag
aactacgcccctggcgaaggcttccagagtgccaaggagaaccccaggtactccagttac
cagggctccaggaacggctatctaggcgggcacggcttcaatgccagggtcatgctggag
acccaggagcttctccgacaggagcagaggcggaaagagcagcagctgaagaagcagcca
ccagctgatggagtcagagggcccttccggcaagatgtacccccttctccatctcaggtg
gctaggctgaacagactgcagacaccggagaaagggcggcccttctactcctga

DBGET integrated database retrieval system