Mus pahari (shrew mouse): 110337935 Help Entry 110337935         CDS       T05929                                  Symbol Elob Name (RefSeq) elongin-B   KO K03873   elongin-B Organism mpah  Mus pahari (shrew mouse) Pathway mpah04066   HIF-1 signaling pathway mpah04120   Ubiquitin mediated proteolysis mpah05170   Human immunodeficiency virus 1 infection mpah05200   Pathways in cancer mpah05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:mpah00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     110337935 (Elob)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     110337935 (Elob)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110337935 (Elob)   09162 Cancer: specific types    05211 Renal cell carcinoma     110337935 (Elob)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     110337935 (Elob)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mpah04121]     110337935 (Elob)    03400 DNA repair and recombination proteins [BR:mpah03400]     110337935 (Elob) Ubiquitin system [BR:mpah04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      110337935 (Elob)    Cul5 complex      110337935 (Elob) DNA repair and recombination proteins [BR:mpah03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      110337935 (Elob) SSDB OrthologParalogGFIT Motif Pfam:  ubiquitin Rad60-SLD Motif Other DBs NCBI-GeneID:  110337935 NCBI-ProteinID:  XP_021076720 Ensembl:  MGP_PahariEiJ_G0023479 LinkDB All DBs Position 21:complement(18802653..18807371) Genome browser AA seq 118 aa AA seqDB search MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPEEQRLYKDDQLLDDGKTLGEC GFTSQTARPQAPATVGLAFRADDTFEALRIEPFSSPPELPDVMKPQDSGGSANEQAVQ NT seq 357 nt NT seq  +upstreamnt  +downstreamnt atggacgtgtttctcatgatccggcgccacaagaccaccatctttacggacgccaaggag tcgagcaccgtgttcgaactgaagcgcatcgtcgagggcatcctcaagcggccgccggag gagcagcggctttacaaggatgaccagctccttgatgatggcaaaactctgggcgagtgt ggcttcactagccagacagcacggccacaggccccagccacagtgggcctggccttccga gcagatgacaccttcgaagctctccgcatcgagcccttctccagccctccagagcttcca gatgtgatgaagccacaggattctggaggcagtgccaatgaacaagctgtgcagtga

DBGET integrated database retrieval system