KEGG   Mus pahari (shrew mouse): 110338169
Entry
110338169         CDS       T05929                                 

Gene name
Bak1
Definition
(RefSeq) bcl-2 homologous antagonist/killer isoform X1
  KO
K14021  Bcl-2 homologous antagonist/killer
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah01524  Platinum drug resistance
mpah04141  Protein processing in endoplasmic reticulum
mpah04210  Apoptosis
mpah04215  Apoptosis - multiple species
mpah05022  Pathways of neurodegeneration - multiple diseases
mpah05132  Salmonella infection
mpah05160  Hepatitis C
mpah05162  Measles
mpah05163  Human cytomegalovirus infection
mpah05164  Influenza A
mpah05165  Human papillomavirus infection
mpah05167  Kaposi sarcoma-associated herpesvirus infection
mpah05168  Herpes simplex virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05170  Human immunodeficiency virus 1 infection
mpah05200  Pathways in cancer
mpah05202  Transcriptional misregulation in cancer
mpah05203  Viral carcinogenesis
mpah05206  MicroRNAs in cancer
mpah05210  Colorectal cancer
mpah05212  Pancreatic cancer
mpah05213  Endometrial cancer
mpah05214  Glioma
mpah05216  Thyroid cancer
mpah05217  Basal cell carcinoma
mpah05218  Melanoma
mpah05220  Chronic myeloid leukemia
mpah05222  Small cell lung cancer
mpah05223  Non-small cell lung cancer
mpah05224  Breast cancer
mpah05225  Hepatocellular carcinoma
mpah05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    110338169 (Bak1)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    110338169 (Bak1)
   04215 Apoptosis - multiple species
    110338169 (Bak1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    110338169 (Bak1)
   05202 Transcriptional misregulation in cancer
    110338169 (Bak1)
   05206 MicroRNAs in cancer
    110338169 (Bak1)
   05203 Viral carcinogenesis
    110338169 (Bak1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    110338169 (Bak1)
   05212 Pancreatic cancer
    110338169 (Bak1)
   05225 Hepatocellular carcinoma
    110338169 (Bak1)
   05226 Gastric cancer
    110338169 (Bak1)
   05214 Glioma
    110338169 (Bak1)
   05216 Thyroid cancer
    110338169 (Bak1)
   05220 Chronic myeloid leukemia
    110338169 (Bak1)
   05217 Basal cell carcinoma
    110338169 (Bak1)
   05218 Melanoma
    110338169 (Bak1)
   05213 Endometrial cancer
    110338169 (Bak1)
   05224 Breast cancer
    110338169 (Bak1)
   05222 Small cell lung cancer
    110338169 (Bak1)
   05223 Non-small cell lung cancer
    110338169 (Bak1)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    110338169 (Bak1)
   05160 Hepatitis C
    110338169 (Bak1)
   05164 Influenza A
    110338169 (Bak1)
   05162 Measles
    110338169 (Bak1)
   05168 Herpes simplex virus 1 infection
    110338169 (Bak1)
   05163 Human cytomegalovirus infection
    110338169 (Bak1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    110338169 (Bak1)
   05169 Epstein-Barr virus infection
    110338169 (Bak1)
   05165 Human papillomavirus infection
    110338169 (Bak1)
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    110338169 (Bak1)
  09164 Neurodegenerative disease
   05022 Pathways of neurodegeneration - multiple diseases
    110338169 (Bak1)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    110338169 (Bak1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:mpah03029]
    110338169 (Bak1)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:mpah02000]
    110338169 (Bak1)
Mitochondrial biogenesis [BR:mpah03029]
 Mitochondrial quality control factors
  Mitochondrial dynamics
   Fission and Fusion factors
    110338169 (Bak1)
Transporters [BR:mpah02000]
 Other transporters
  Pores ion channels [TC:1]
   110338169 (Bak1)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 110338169
NCBI-ProteinID: XP_021077092
Ensembl: MGP_PahariEiJ_G0023612
LinkDB
Position
21
AA seq 209 aa
MASGQGPGPPKEGCDESPSPSEQQVAQDTEEVFRSYVFYLHQQEQETQGAAAPANPEMDN
LPLEPNSVLGQVGRQLALIGDDINRRYDTEFQNLLEQLQPTAGNAYELFTKIASSLFKSG
ISWGRVVALLGFGYRLALYVYQRGLTGFLGQVTCFLADIILHHYIARWIAQRGGWVAALN
LRRDPILSVMVIFGVVLLGQFVVHRFFRS
NT seq 630 nt   +upstreamnt  +downstreamnt
atggcatctggacaaggaccaggtcctccgaaggagggctgtgacgagtccccgtcccct
tctgaacagcaggttgcccaggacacagaggaggtctttcgaagctacgttttttacctc
caccagcaggaacaagagacccagggggcggccgcccctgccaaccccgagatggacaac
ttgcccctggaacccaacagcgtcttgggtcaggtgggtcggcagcttgctctcatcgga
gatgatattaaccggcgctatgacacggagttccagaatttactagaacagcttcagccc
acagcagggaatgcctacgaactcttcaccaagatcgcctccagcctatttaagagtggc
atcagctggggccgcgtggtggctctcctgggctttggctaccgtctggccctgtacgtc
taccagcgtggtttgaccggcttcctgggccaggtgacctgctttttggctgatatcata
ctgcaccattacattgccagatggatcgcacagagaggtggttgggtggcagccctgaat
ttgcgtagagaccccatcctgagcgtaatggtgatttttggtgtggttctgttgggccaa
ttcgtggtacacagattcttcagatcatga

DBGET integrated database retrieval system