KEGG   Mus pahari (shrew mouse): 110338267
Entry
110338267         CDS       T05929                                 
Symbol
Cd274
Name
(RefSeq) programmed cell death 1 ligand 1
  KO
K06745  programmed cell death 1 ligand 1
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04514  Cell adhesion molecules
mpah05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110338267 (Cd274)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    110338267 (Cd274)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:mpah04090]
    110338267 (Cd274)
CD molecules [BR:mpah04090]
 Proteins
  110338267 (Cd274)
SSDB
Motif
Pfam: Ig_3 V-set ig I-set Ig_2 C2-set_2 Ig_6 C1-set DUF1356
Other DBs
NCBI-GeneID: 110338267
NCBI-ProteinID: XP_021077219
Ensembl: MGP_PahariEiJ_G0014351
LinkDB
Position
1:140947284..140965638
AA seq 290 aa
MRIFAVVIFTAWCHLLQAFTITAPKDLYVVEYGSNVTMECRFPVEQELDLHALVVYWEKE
DKQVIQLVAGEEDIKPQHSSFRGRASLPKDQLLKGNAALQITDVKLQDAGVYCCMISYGG
ADYKRITLKVNAPYRKINQRISVDPATSEHELICQAEGYPEAEVIWTNSDHQPVSGKRTV
TTSRTEEMLLNVTSSLRVNATANDVFYCTFWRSQSGENHTAELIIPELPATRLPQNRTHW
VLLGSILLFLIVGSTVLFFLRKQVRMLDVEKCGIEDTSSKNRTDTQFEET
NT seq 873 nt   +upstreamnt  +downstreamnt
atgaggatatttgctgtcgttatattcacagcctggtgtcacttgctacaggcatttact
atcacggctccaaaggacctgtacgtggtggagtatggcagcaacgtcacgatggagtgc
agattccctgtagaacaggagctggacctgcatgcattagtggtgtactgggaaaaggaa
gacaagcaagtgattcagcttgtggcgggagaggaggacataaagcctcagcacagtagc
ttcagggggagagcctccttgccaaaggaccagcttctgaagggaaatgctgcacttcag
atcacggatgtcaagctgcaggacgcaggcgtctactgctgcatgatcagctacggcggt
gcggactacaagcgaatcacattgaaagtcaatgccccgtaccgcaaaatcaaccagaga
atttccgtggatccggccacttctgagcatgaactaatctgtcaggctgagggttaccca
gaagccgaagtaatctggacaaacagtgaccaccaaccggtgagtgggaagagaactgtc
accacttcccggacagaggagatgcttctcaatgtaaccagcagtctgagggtcaacgcc
acagcgaatgatgttttctactgtacgttttggagatcacagtcaggggaaaaccacaca
gctgagctgatcatcccagaactgcctgcaacacgtctcccacaaaacaggactcactgg
gtgcttctgggatccatcctgttgttcctcattgtagggtccacggtcctcttcttcttg
agaaaacaagtgagaatgctagatgtggaaaaatgcggcatcgaagatacaagctcaaaa
aaccgaaccgatacgcaattcgaggagacgtaa

DBGET integrated database retrieval system