KEGG   Mus pahari (shrew mouse): 110338926
Entry
110338926         CDS       T05929                                 
Symbol
Itgal
Name
(RefSeq) integrin alpha-L isoform X1
  KO
K05718  integrin alpha L
Organism
mpah  Mus pahari (shrew mouse)
Pathway
mpah04015  Rap1 signaling pathway
mpah04514  Cell adhesion molecules
mpah04613  Neutrophil extracellular trap formation
mpah04650  Natural killer cell mediated cytotoxicity
mpah04670  Leukocyte transendothelial migration
mpah04810  Regulation of actin cytoskeleton
mpah05144  Malaria
mpah05150  Staphylococcus aureus infection
mpah05166  Human T-cell leukemia virus 1 infection
mpah05169  Epstein-Barr virus infection
mpah05323  Rheumatoid arthritis
mpah05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:mpah00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    110338926 (Itgal)
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules
    110338926 (Itgal)
 09140 Cellular Processes
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    110338926 (Itgal)
 09150 Organismal Systems
  09151 Immune system
   04613 Neutrophil extracellular trap formation
    110338926 (Itgal)
   04650 Natural killer cell mediated cytotoxicity
    110338926 (Itgal)
   04670 Leukocyte transendothelial migration
    110338926 (Itgal)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    110338926 (Itgal)
   05169 Epstein-Barr virus infection
    110338926 (Itgal)
  09171 Infectious disease: bacterial
   05150 Staphylococcus aureus infection
    110338926 (Itgal)
  09174 Infectious disease: parasitic
   05144 Malaria
    110338926 (Itgal)
  09163 Immune disease
   05323 Rheumatoid arthritis
    110338926 (Itgal)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    110338926 (Itgal)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:mpah04147]
    110338926 (Itgal)
   04515 Cell adhesion molecules [BR:mpah04515]
    110338926 (Itgal)
   04090 CD molecules [BR:mpah04090]
    110338926 (Itgal)
Exosome [BR:mpah04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   110338926 (Itgal)
Cell adhesion molecules [BR:mpah04515]
 Integrins
  Integrin alpha subunits
   110338926 (Itgal)
CD molecules [BR:mpah04090]
 Proteins
  110338926 (Itgal)
SSDB
Motif
Pfam: Integrin_alpha2 VWA FG-GAP VWA_2 FG-GAP_3 Integrin_alpha FG-GAP_2
Other DBs
NCBI-GeneID: 110338926
NCBI-ProteinID: XP_021078061
Ensembl: MGP_PahariEiJ_G0013706
LinkDB
Position
1:96789237..96830117
AA seq 1162 aa
MSFRIAGPRLFLLGLQLFVKAWSYNLDTRPTQSFLAQAGRHFGYQVLQVGDGVVVGAPGE
GDNMGGLYHCHPSSEFCQPVSLHGSNHTSKYLGMTLATDAAKGSLLACDPGLSRTCDQNT
YLSGLCYLFPQSLEGPMLQNRPAYQECMKGKVDLVFLFDGSQSLDRKDFEKILEFMKDVM
RKLSNTSYQFAAVQFSTECRTEFTFSDYVKQNKNPDVLLGNVQPMFLLTNTFRAINYVVA
HVFKEESGARPDATKVLVIITDGEASDNGNISAAQGITRYIIGIGKHFATVQKQKTLHIF
ASKPVEEFVKILDTFEKLKDLFTDLQRKIYAIEGTSKQDLTSFNMELSSSGISADLSKGH
AVVGAVGAKDWAGGFLDLSEDLQGATFVGEEPLTSDVRGGYLGYTVAWLASRSARPLLAA
GAPRYQHVGQVLLFQAPVAGGRWNQAQKIEGTQIGSYFGGELCSVDLDQDGEAELLLIGA
PLFYGEQRGGRVFTYRRRQSLFEMVSELQGDPGYPLGRFGAAITALMDINGDGLTDVAVG
APLEEQGAVYIFNGKPGGLGPQASQRIQGTQVFPGIRWFGRSIHGVKDLGGDRLADVVVG
AEGRVIVLSSRPVVDVVTELSFSPEEIPVHEVECSYSASEEQKHGVKLKACFWIHPLTLK
FQGRLIANLSYTLQLDGHRTRSRGLFPGGSHELSGNTSVTPDKSCLDFHFHFPICIQDLI
SPINVSLNFSLLEEEGTPRDQKVGREMRPILRPSIHAVTKEIPFEKNCGEDKKCEADLAL
SSPARSGALRLMTSASLAVEWTLRNSGEDAYWVRLDLDFPQGLSFRKVEMLQPHRQIPVS
CEELTEGSSLLTKTLKCNVSSPIFKAGQQVSLQVMFNTLLNSSWGDFVELNGTVHCENEN
SSLQEDNSDTTRIPVLYPVNILTEDQENSTLYISFTPKGPTTQQVQHVYQVRIQPSPYDH
NMPTLEALVGVPRPHSEGPITYTWSVQTDPLVTCHREDLKRPSSEAEQPCLPGVQFRCPV
VFRREILIQVTGTVELSEEIKASSTLSLCSSLSVSFNSSKHFHLYGSKASEAQVLMKVDV
IYEKEMLHLYVLSGIGGLVLLFLIFLALYKVGFFKRNLKEKMEADGGVPNGSPPEDTDPL
AVPGEETKDMGCLEPLHESDKD
NT seq 3489 nt   +upstreamnt  +downstreamnt
atgagtttccggattgccggccccagactttttctactgggactccagctgtttgtcaag
gcctggagctacaacctggacacaaggcctacgcagagcttcttggcacaagctggaaga
cattttgggtaccaggtcttgcaggtcggagatggggttgtcgtgggagccccaggtgag
ggggacaacatgggaggcctctatcactgccatccgagcagcgagttctgccagccagtc
agcctacatggctcaaaccatacctccaagtacttgggaatgacgctggcaacagacgcc
gccaagggaagccttttggcctgtgaccccggactgtcgcggacatgtgatcagaacacc
tacctcagtggcctctgctacctctttccccagagtctggagggacccatgctacaaaac
cgtccggcctatcaggagtgtatgaagggcaaagtcgacctggtgtttctgttcgatggc
tcacagagcttggatagaaaggactttgaaaaaatcctggaattcatgaaggatgtgatg
aggaaactcagcaacacttcttaccagtttgctgccgttcagttttccacagagtgcaga
acagaatttactttctcggactatgttaagcagaacaagaaccccgatgttctgctaggc
aacgtgcagcccatgttcttgctgaccaatacctttcgtgccatcaactatgtggtggca
catgtgttcaaagaagaatctggtgccaggccagatgctaccaaggtgcttgtcatcatt
acagacggggaggcaagtgataacggcaacatcagtgcggcccaaggcataacccgctat
atcatcgggattggcaagcattttgccacagtacaaaagcagaagacgctccacatattt
gcctcaaaacctgtagaggaatttgtcaagattctagacacatttgagaaactgaaggat
ctatttactgacctgcagaggaaaatttatgctattgagggcacaagcaaacaggacctg
acatcctttaatatggaactctcctccagtgggatcagcgcagacctcagcaagggccat
gcagttgtgggagccgttggagctaaggattgggccgggggctttctagacctgagtgaa
gacctccaaggtgccacatttgttggggaggagccgctgacctcagatgtgagaggaggt
tacctgggttacactgtggcctggctggcctcccggagcgccagacccctgctggcagca
ggagccccacggtaccagcatgtgggacaagtgctgcttttccaagccccagtggctgga
ggacgttggaaccaggcccagaagatagaagggactcagatcggatcttactttggtggg
gagctatgtagcgttgacctggaccaagatggcgaggcagagctgctgctgattggagct
cccctgttctatggggagcagagaggaggccgagtgttcacttaccggagaagacagtcg
ctgttcgaaatggtctcagagctacagggtgaccctggctacccgcttggtcggtttgga
gctgccataactgccctgatggacatcaatggggatgggctgactgatgtggctgtggga
gcccccctggaggagcagggggctgtgtatatcttcaatgggaagcctggtgggctaggt
ccccaggcaagccagcgtattcaaggaacccaggtgttcccgggaatccggtggtttggc
cgctccatccatggggtgaaggaccttggaggggacaggctggcagatgtggttgtagga
gctgagggtcgggtgattgtgctgagctcgaggcccgtggtggatgttgtcactgagctg
tcgttctccccagaggaaatcccagtgcatgaggtggagtgctcctactcagccagtgag
gagcagaagcacggagtcaaactcaaggcgtgcttctggatccaccccctcacgttgaag
tttcaaggtcgcctgattgccaacctcagctacaccctgcagctggatggccatcggacg
aggagccgagggctgttcccaggaggaagccacgagctcagtggaaacacctccgtcacc
ccagataaatcctgcttggacttccacttccacttcccgatctgcattcaagacctcatc
tcccctatcaatgtctctctgaatttctctcttttggaggaagaagggacaccaagggac
caaaaggtgggcagggagatgcggcctatcctgagaccttcaatccacgcagtgactaag
gagatcccttttgagaagaactgtggtgaagataagaagtgtgaagcagacctggccctg
tcgtcccctgccagaagtggagccctgcgtctgatgacctctgccagccttgctgtggag
tggacactgaggaactcgggagaagatgcctactgggtgcgattagacctggacttccct
cagggtctctccttccggaaagtggagatgcttcagccacacaggcaaatacccgtgagc
tgcgaggagctcaccgaggggtcaagtctcctgactaagacactgaagtgcaatgtaagc
tctcccatcttcaaagcaggccagcaggtgagcctccaggtgatgtttaacacactactc
aacagctcctggggagacttcgtcgagctgaatggcactgtgcactgtgagaatgagaac
tcaagcctccaggaggacaactcagacaccacccgcatccccgtcctgtaccctgtcaac
atccttactgaggaccaggagaactccaccctctatatcagtttcacccctaaaggtccc
acgacccaacaagtccagcatgtctaccaggtgaggattcagccctctccctatgaccac
aacatgcccacactggaggccttggttggggtgcctcggcctcacagtgagggccccatc
acatacacatggagtgtacagacggatccccttgtcacttgccaccgtgaggacctgaag
aggccatccagcgaagccgagcagccttgtctgcctggagtccagttccgctgtccagtt
gtcttcaggcgggagatcctcatccaagtgacagggactgtggaactctccgaggaaatc
aaggcctcttccacactcagcctctgcagctcactttctgtctccttcaacagcagcaag
catttccatttgtatggcagcaaagcctccgaggcccaggtcctcatgaaggtggatgtg
atctatgagaaggagatgcttcacctgtacgtgctcagcggcattggggggctggtgctg
ctgttcctgatcttcctggcactctacaaggttggcttcttcaagcggaacctgaaggag
aagatggaggctgatggaggtgttccaaatggaagccctccagaagacaccgaccctctg
gcagtacctggggaagagaccaaagatatgggctgtctggagcccctccatgagagtgac
aaggactaa

DBGET integrated database retrieval system