Mus pahari (shrew mouse): 110339002 Help Entry 110339002         CDS       T05929                                  Symbol Eloc Name (RefSeq) LOW QUALITY PROTEIN: elongin-C   KO K03872   elongin-C Organism mpah  Mus pahari (shrew mouse) Pathway mpah04066   HIF-1 signaling pathway mpah04120   Ubiquitin mediated proteolysis mpah05170   Human immunodeficiency virus 1 infection mpah05200   Pathways in cancer mpah05211   Renal cell carcinoma Brite KEGG Orthology (KO) [BR:mpah00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     110339002 (Eloc)  09130 Environmental Information Processing   09132 Signal transduction    04066 HIF-1 signaling pathway     110339002 (Eloc)  09160 Human Diseases   09161 Cancer: overview    05200 Pathways in cancer     110339002 (Eloc)   09162 Cancer: specific types    05211 Renal cell carcinoma     110339002 (Eloc)   09172 Infectious disease: viral    05170 Human immunodeficiency virus 1 infection     110339002 (Eloc)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:mpah04121]     110339002 (Eloc)    03400 DNA repair and recombination proteins [BR:mpah03400]     110339002 (Eloc) Ubiquitin system [BR:mpah04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      110339002 (Eloc)    Cul5 complex      110339002 (Eloc) DNA repair and recombination proteins [BR:mpah03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      110339002 (Eloc) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  110339002 NCBI-ProteinID:  XP_021078120 LinkDB All DBs Position 22:1203392..1221490 Genome browser AA seq 122 aa AA seqDB search LELEEEEEEGGGGGGGGRVGDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGT IKAMLSGPGQFAENETNETGPSRRLPASATSSRLDLHGDCSAILRPGDPAALDLLDRPLH LL NT seq 369 nt NT seq  +upstreamnt  +downstreamnt ctggaactggaggaggaagaagaagagggaggaggaggaggaggaggaggaagagttggt gatggagaggagaaaacctatggtggctgtgaaggccctgatgctatgtatgtgaaatta atatcttctgatggtcatgaatttatagtaaaaagagaacatgcattaacatcaggaaca ataaaggccatgttgagtggtccaggtcagtttgctgagaatgaaaccaacgagactgga ccttcacggagactgccggcttctgctacatcatctagactggaccttcatggagactgc tcggctatcctgcgtcctggagaccctgcagctttggatctgctggacaggcctcttcac ctgctctag

DBGET integrated database retrieval system