Mus pahari (shrew mouse): 36165335 Help Entry 36165335          CDS       T05929                                  Symbol ND4L, C2G80_mgp05 Name (RefSeq) NADH dehydrogenase subunit 4L   KO K03882   NADH-ubiquinone oxidoreductase chain 4L [EC:7.1.1.2] Organism mpah  Mus pahari (shrew mouse) Pathway mpah00190   Oxidative phosphorylation mpah01100   Metabolic pathways mpah04714   Thermogenesis mpah04723   Retrograde endocannabinoid signaling mpah05010   Alzheimer disease mpah05012   Parkinson disease mpah05014   Amyotrophic lateral sclerosis mpah05016   Huntington disease mpah05020   Prion disease mpah05022   Pathways of neurodegeneration - multiple diseases mpah05208   Chemical carcinogenesis - reactive oxygen species mpah05415   Diabetic cardiomyopathy Module mpah_M00142   NADH:ubiquinone oxidoreductase, mitochondria Brite KEGG Orthology (KO) [BR:mpah00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     36165335 (ND4L)  09150 Organismal Systems   09156 Nervous system    04723 Retrograde endocannabinoid signaling     36165335 (ND4L)   09159 Environmental adaptation    04714 Thermogenesis     36165335 (ND4L)  09160 Human Diseases   09161 Cancer: overview    05208 Chemical carcinogenesis - reactive oxygen species     36165335 (ND4L)   09164 Neurodegenerative disease    05010 Alzheimer disease     36165335 (ND4L)    05012 Parkinson disease     36165335 (ND4L)    05014 Amyotrophic lateral sclerosis     36165335 (ND4L)    05016 Huntington disease     36165335 (ND4L)    05020 Prion disease     36165335 (ND4L)    05022 Pathways of neurodegeneration - multiple diseases     36165335 (ND4L)   09166 Cardiovascular disease    05415 Diabetic cardiomyopathy     36165335 (ND4L)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03029 Mitochondrial biogenesis [BR:mpah03029]     36165335 (ND4L) Enzymes [BR:mpah01000]  7. Translocases   7.1  Catalysing the translocation of protons    7.1.1  Linked to oxidoreductase reactions     7.1.1.2  NADH:ubiquinone reductase (H+-translocating)      36165335 (ND4L) Mitochondrial biogenesis [BR:mpah03029]  Mitochondrial DNA transcription, translation, and replication factors   Mitochondrial DNA-encoded proteins    Mitochondrial respiratory chain complex I     36165335 (ND4L) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Oxidored_q2 Motif Other DBs NCBI-GeneID:  36165335 NCBI-ProteinID:  YP_009450482 UniProt:  A0A343C6V1 LinkDB All DBs Position MT: Genome browser AA seq 98 aa AA seqDB search MSYTFLNLTLAFILSLLGTLMFRSHLMSTLLCLEGMMLSLFIMTAVTSLNSNSMNSMPIP IIILVFAACEAAVGLALLVKVSNTYGTDYVQNLNLLQC NT seq 297 nt NT seq  +upstreamnt  +downstreamnt atgtcctataccttcctcaatctcaccctagcttttattctatcactcttagggacctta atgttccgctcccacctaatatccactcttctatgtttagaaggtataatattatcccta tttattataactgcagtaacctccctaaactctaactcaataaactcaataccaatcccc attattattctagtctttgcagcatgcgaagcagctgtaggcctagccttattagttaaa gtttcaaatacatatggaactgattacgtccaaaaccttaatcttctacaatgttaa

DBGET integrated database retrieval system