Marinomonas posidonica: Mar181_0558 Help Entry Mar181_0558       CDS       T01508                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mpc  Marinomonas posidonica Pathway mpc01100   Metabolic pathways mpc01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mpc00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Mar181_0558    00074 Mycolic acid biosynthesis     Mar181_0558   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Mar181_0558 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  AEF53617 UniProt:  F6CZV6 LinkDB All DBs Position complement(607370..607636) Genome browser AA seq 88 aa AA seqDB search MSDLNTELKQMIIDALDLEDIDTDDIEDDAPLFIEGLGLDSIDALEIGLALQQRYSIKLK ADSEETKAHFASINALVKLVQPHQTNNV NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atgtctgaccttaataccgaacttaaacaaatgatcattgatgcacttgatctggaagat attgatacagatgacattgaagacgatgcgcctcttttcattgaaggactggggttagac tccatcgacgcccttgagattggcttagcattgcagcaacgctacagcataaagctaaaa gctgattcagaggaaaccaaagcacactttgccagcattaatgccctggtaaaacttgtt caaccacaccaaacaaacaacgtgtaa

DBGET integrated database retrieval system