Mycoplasma putrefaciens KS1: MPUT_0187 Help Entry MPUT_0187         CDS       T01599                                  Name (GenBank) putative acyl carrier protein   KO K02078   acyl carrier protein Organism mpf  Mycoplasma putrefaciens KS1 Pathway mpf01100   Metabolic pathways mpf01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mpf00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MPUT_0187    00074 Mycolic acid biosynthesis     MPUT_0187   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MPUT_0187 BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding Ribosomal_L50 ACP_SdgA_C PP-binding_2 Motif Other DBs NCBI-ProteinID:  AEM68581 UniProt:  A0A7U3ZS80 LinkDB All DBs Position 191408..191632 Genome browser AA seq 74 aa AA seqDB search MNIYEEIVRKLKSRGAKGAITQNSEFKKMGLDSLDLMDLIVELEDTLDIRIDDEQLLSLK TISDLLQVIQELKK NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atgaatatttatgaagaaattgttagaaaacttaaatctcgaggagctaaaggagcaatt actcaaaactcagaatttaaaaaaatgggtttagattctttggatttaatggatttaatt gttgaactagaagataccttagatattagaatcgatgatgagcaattactttctttaaaa actatttctgatttattacaagtgattcaagagttgaaaaaataa

DBGET integrated database retrieval system