Mesotoga prima: Theba_0478 Help Entry Theba_0478        CDS       T02123                                  Name (GenBank) hypothetical protein   KO K00176   2-oxoglutarate ferredoxin oxidoreductase subunit delta [EC:1.2.7.3] Organism mpg  Mesotoga prima Pathway mpg00020   Citrate cycle (TCA cycle) mpg00720   Other carbon fixation pathways mpg01100   Metabolic pathways mpg01110   Biosynthesis of secondary metabolites mpg01120   Microbial metabolism in diverse environments mpg01200   Carbon metabolism mpg01210   2-Oxocarboxylic acid metabolism Brite KEGG Orthology (KO) [BR:mpg00001]  09100 Metabolism   09101 Carbohydrate metabolism    00020 Citrate cycle (TCA cycle)     Theba_0478   09102 Energy metabolism    00720 Other carbon fixation pathways     Theba_0478 Enzymes [BR:mpg01000]  1. Oxidoreductases   1.2  Acting on the aldehyde or oxo group of donors    1.2.7  With an iron-sulfur protein as acceptor     1.2.7.3  2-oxoglutarate synthase      Theba_0478 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4 Fer4_7 Fer4_10 Fer4_6 Fer4_2 Fer4_21 Fer4_9 Fer4_16 LdpA_Fe-S-bd Fer4_4 Fer4_8 Fer4_13 Fer4_15 Fer4_3 Fer4_17 Fer4_18 Fer4_22 Motif Other DBs NCBI-ProteinID:  AFK06204 UniProt:  I2F2Q1 LinkDB All DBs Position 527050..527274 Genome browser AA seq 74 aa AA seqDB search MAVRKQYKVNINLALCKSCGICYWICPTKTITKGELGRPKVVDHKTCIGCLMCENACPDF AIDVREVEAVKEDA NT seq 225 nt NT seq  +upstreamnt  +downstreamnt atggctgtaagaaagcagtacaaagtaaatatcaatttggctctgtgcaagagttgtgga atatgctactggatctgcccgacgaaaacgattactaaaggggagcttggcaggccaaaa gtggttgatcacaagacatgcataggttgtctgatgtgcgagaacgcatgccctgacttt gcgattgatgtgcgggaagtggaggcggtgaaagaggatgcgtga

DBGET integrated database retrieval system