Mangrovibacter phragmitis: MPHASIOC01_002473 Help Entry MPHASIOC01_002473 CDS       T10640                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism mphg  Mangrovibacter phragmitis Pathway mphg01100   Metabolic pathways mphg01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mphg00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MPHASIOC01_002473    00074 Mycolic acid biosynthesis     MPHASIOC01_002473   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MPHASIOC01_002473 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding VHL_C PP-binding_2 Motif Other DBs NCBI-ProteinID:  XCE77457 LinkDB All DBs Position 2574872..2575132 Genome browser AA seq 86 aa AA seqDB search MVNRDAVMEYILSCLRETLENGPEVKPDSDLVNDLGLESIRVLDLLMKLEDEFDISIPIN ILLDVRTPEQLLNALIPHLEKAHGTL NT seq 261 nt NT seq  +upstreamnt  +downstreamnt atggtgaatcgcgatgctgttatggagtacatcctttcctgcttaagagaaacgctggaa aacggacctgaagttaaaccggatagcgacctggtcaatgatcttggtctggaatccatt cgtgtgctggatctgttaatgaaactggaagatgaatttgatatttccattcctatcaac atcttgttggatgtcagaacaccagagcagttactgaatgcgttgatccctcatctggag aaagctcatgggactttatga

DBGET integrated database retrieval system