Mycolicibacterium phocaicum: MPHO_50900 Help Entry MPHO_50900        CDS       T07283                                  Name (GenBank) ferredoxin   KO K24530   ferredoxin Organism mphu  Mycolicibacterium phocaicum Pathway mphu01100   Metabolic pathways mphu01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mphu00001]  09100 Metabolism   09109 Metabolism of terpenoids and polyketides    00522 Biosynthesis of 12-, 14- and 16-membered macrolides     MPHO_50900  09180 Brite Hierarchies   09181 Protein families: metabolism    01008 Polyketide biosynthesis proteins [BR:mphu01008]     MPHO_50900 Polyketide biosynthesis proteins [BR:mphu01008]  Nonribosomal peptide tailoring proteins   Others    MPHO_50900 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Fer4_13 Fer4_15 Fer4_19 Motif Other DBs NCBI-ProteinID:  BBZ58098 LinkDB All DBs Position 5250257..5250448 Genome browser AA seq 63 aa AA seqDB search MKIALHAGKCDGIGMCEAAAPDIFEVGDDGLVHVLDPTPDEDRRHDVQEAIDSCPVRALL LED NT seq 192 nt NT seq  +upstreamnt  +downstreamnt atgaagatcgctctgcacgccggcaagtgcgacggaatcggcatgtgtgaggccgccgca ccagacatcttcgaagtcggcgacgacggcctcgtccacgttctcgatcccacgcccgac gaagaccgccgccacgacgtccaagaagcaatcgacagctgtcccgtgcgagcgctgctc ctcgaggactga

DBGET integrated database retrieval system