Methylobacterium phyllosphaerae: MCBMB27_01521 Help Entry MCBMB27_01521     CDS       T04968                                  Name (GenBank) acyl carrier protein AcpP   KO K02078   acyl carrier protein Organism mphy  Methylobacterium phyllosphaerae Pathway mphy01100   Metabolic pathways mphy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:mphy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     MCBMB27_01521    00074 Mycolic acid biosynthesis     MCBMB27_01521   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     MCBMB27_01521 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 Ribosomal_L12_N ACP_SdgA_C DUF1493 DUF5783 Motif Other DBs NCBI-ProteinID:  APT30812 UniProt:  A0AAE8HN30 LinkDB All DBs Position 1637278..1637517 Genome browser AA seq 79 aa AA seqDB search MSDIAERVKKIVVEHLGVEPEKVVESANFIDDLGADSLDTVELVMAFEEEFNVEIPDDAA ETIQTVGDAVKFLEKNSAA NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcgatatcgctgagcgcgtgaagaagatcgtcgtcgagcacctgggcgtggagccc gagaaggtggtcgagagcgccaacttcatcgacgacctcggtgccgacagcctcgacacg gtcgagctggtcatggccttcgaggaagagttcaacgtcgagatcccggacgacgctgcc gagaccatccagacggtcggcgacgccgtgaagttcctggagaagaactccgccgcctaa

DBGET integrated database retrieval system