Methanolacinia petrolearia: Mpet_0096 Help Entry Mpet_0096         CDS       T01312                                  Name (GenBank) Ribosomal protein S27a   KO K02977   ubiquitin-small subunit ribosomal protein S27Ae Organism mpi  Methanolacinia petrolearia Pathway mpi03010   Ribosome Brite KEGG Orthology (KO) [BR:mpi00001]  09120 Genetic Information Processing   09122 Translation    03010 Ribosome     Mpet_0096   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     Mpet_0096  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03011 Ribosome [BR:mpi03011]     Mpet_0096    04121 Ubiquitin system [BR:mpi04121]     Mpet_0096   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:mpi04147]     Mpet_0096 Ribosome [BR:mpi03011]  Ribosomal proteins   Eukaryotes    Small subunit     Mpet_0096   Archaea     Mpet_0096 Ubiquitin system [BR:mpi04121]  Ubiquitins and ubiquitin-like proteins   Ubiquitins    Mpet_0096 Exosome [BR:mpi04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    Mpet_0096   Exosomal proteins of colorectal cancer cells    Mpet_0096 SSDB OrthologParalogGFIT Motif Pfam:  Ribosomal_S27 Lar_restr_allev IBR Ribosomal_L37e Zn_ribbon_11 Rcat_RNF216 FtrD-like Zn_ribbon_RPAB4 Phage_gp86 MqsA_antitoxin Zn_ribbon_13 Zn_ribbon_Nudix Cas12f1-like_TNB Motif Other DBs NCBI-ProteinID:  ADN34877 UniProt:  E1RDY6 LinkDB All DBs Position 108321..108476 Genome browser AA seq 51 aa AA seqDB search MGVKRYTYYKVEDDKAVTEKKHCPRCGPGVFMAEHKDRVSCGKCGYTEFNK NT seq 156 nt NT seq  +upstreamnt  +downstreamnt atgggagtaaagcgttatacctattacaaagtcgaagacgacaaggccgttacagaaaag aagcactgcccgcgctgcggaccgggtgtctttatggcggagcacaaggatcgtgtctcc tgcggcaagtgcggatatactgaatttaacaaataa

DBGET integrated database retrieval system