Methylophaga pinxianii: LGT42_009015 Help Entry LGT42_009015      CDS       T08312                                  Symbol queF Name (GenBank) preQ(1) synthase   KO K09457   7-cyano-7-deazaguanine reductase [EC:1.7.1.13] Organism mpin  Methylophaga pinxianii Pathway mpin00790   Folate biosynthesis mpin01100   Metabolic pathways Module mpin_M00988   PreQ1 biosynthesis, GTP => 7-Aminomethyl-7-deazaguanine Brite KEGG Orthology (KO) [BR:mpin00001]  09100 Metabolism   09108 Metabolism of cofactors and vitamins    00790 Folate biosynthesis     LGT42_009015 (queF)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03016 Transfer RNA biogenesis [BR:mpin03016]     LGT42_009015 (queF) Enzymes [BR:mpin01000]  1. Oxidoreductases   1.7  Acting on other nitrogenous compounds as donors    1.7.1  With NAD+ or NADP+ as acceptor     1.7.1.13  preQ1 synthase      LGT42_009015 (queF) Transfer RNA biogenesis [BR:mpin03016]  Prokaryotic type   tRNA modification factors    Other tRNA modification factors     LGT42_009015 (queF) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  QueF Fe-S_biosyn GTP_cyclohydroI QueF_N CobW_C Motif Other DBs NCBI-ProteinID:  UPH44652 LinkDB All DBs Position 1867854..1868243 Genome browser AA seq 129 aa AA seqDB search MSTLPSKQLETFDNAVPERDYTIHIETPEFTCLCPKTGQPDFATIKIDYVPDLKCVELKS LKLYFWSYREEGGFHEKLTNQILTDLVAATEPRFMRVTGIFNVRGGVYTNVVAEYRKEGW VAPTPVHLP NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtctacgctaccaagcaaacaactggaaaccttcgataacgcagtaccggagcgggat tataccatccacatcgaaacacctgaatttacttgcctgtgtccgaaaaccggtcagccg gattttgccacgattaagattgattatgtaccggatttgaaatgcgtagaactgaaatct ctgaaactgtatttctggtcttaccgggaagaaggcggttttcatgaaaaactgaccaat caaattctcaccgatctggtagctgcaactgaaccacgatttatgcgcgtaacgggcatt ttcaacgttcgaggtggtgtttacacaaatgtggtggctgaataccgtaaagaaggttgg gttgcccccactcccgttcatcttccttaa

DBGET integrated database retrieval system